Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|044500
Gene name
Locationscaffold_02:1357283..1360829
Strand-
Gene length (bp)3546
Transcript length (bp)3348
Coding sequence length (bp)3348
Protein length (aa) 1116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 3.4E-227 429 917
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-07 603 761

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 12 1025 0.0E+00
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 68 919 0.0E+00
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 69 977 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 9 1035 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 442 924 7.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 12 1025 0.0E+00
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 68 919 0.0E+00
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 69 977 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 9 1035 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 442 924 7.0E-176
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 362 919 3.0E-171
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 440 927 4.0E-168
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 440 942 4.0E-168
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 443 910 3.0E-162
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 442 886 1.0E-140
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 441 985 4.0E-129
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 441 923 6.0E-129
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 69 364 1.0E-27
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 69 369 1.0E-23
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 69 368 6.0E-22
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 69 365 7.0E-17
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 69 351 3.0E-16
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 69 361 1.0E-14
sp|P04340|NODC_RHILV N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae GN=nodC PE=3 SV=1 596 768 1.0E-07
sp|Q92839|HYAS1_HUMAN Hyaluronan synthase 1 OS=Homo sapiens GN=HAS1 PE=1 SV=2 601 768 8.0E-07
sp|Q61647|HYAS1_MOUSE Hyaluronan synthase 1 OS=Mus musculus GN=Has1 PE=1 SV=1 601 768 8.0E-07
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 59 160 1.0E-06
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 609 880 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 104 123 19
2 327 349 22
3 792 814 22
4 824 843 19
5 850 872 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|044500
MALRFQANPHVSDVPIPTARQPHLSGATVRRAKTLTRPERGVAPVPLINPPAVSSSTPDVAIYNGSISWRIFSRI
ITLWAPDFLLSSIGGMKDSNVRQAWREKIGLCAIIAVLCAAVGFATVGFQKVLCPENANSNARFLDVGATPGTLG
IQGVMYNVSSARSVNGVDLLRLSQSPGLDITTYFQRDASQFKSCQGLNFRVALDPPCPSATQCTLPPINSSTFQS
LSIFDTGFLAGYSWDQVSSLRNYFVLDGAVLNMAPYFALHSQEVPNDSVDRALRTVLQQQLIGAGKDGTRLFFNR
ADLKSVVPCLKERYYAGNIDKVTPGCFVSSLFLYTGLIVILGLVFVRFVMACVFNWFMSERLADTPTSQDLSRSA
ISPAVMPGDANISVNNKSGTAPWANDVSKKLQRGPKSIASNSSATLTNSDGSTPIMSLAQIGAELFAVCLVTCYS
EGEESLRTTLDSISATTYSDARKLLFVVADGMITGAGEKRSTPDICVSLLEADPRFGNPISMTYNAVGSGAKAQN
RAMVYAGHYTVAGRRTPMVIVVKCGTEREAATDKKPGNRGKRDSQLILMNFFSRVTYNDRMTPLDFDLFRKIHAL
MGVTPDFFEVCLMVDADTKVFPESLGYLVNCMHHDQMIMGVCGETRIANKRQSWVTAIQVFEYFISHHLAKAFEL
KARKSTGDDWVPLIVKPEIVKEYSQSEVTTLHQKNLLLLGEDRFLTTILLRTFPNRKMMFLPQARCRTIVPDTFK
VLLSQRRRWINSTIHNLMELVLVRNLCGTFCFSMQFVVFMDLLGTVVLPIAIALTYSLIIGMGFNPPKTFEEAIP
LMLLIAVLGLPAILILLTTRKLIYVFWMLIYLFALPVWNFVLPIYAFWHFDDFSWGQTRKIEGEAKGEGHGDEGG
KNMSPSVPMRRWEDWERSRLRKLRREERRRRDFERAHPSGYFAGDGDLLSVRTDTRSQYDGSDTLSIGSSDDDHW
GPQIGGYNEHNAQNPLPPVSLHVPNQALQNAKTFNNAELEAMLESGFDDRPTPPTSTYAPRYQLSDTGSSTQLAG
VAGNGYAPLTRATSPGLGHAPSSISHTLSPTSPTIFPGEVPKSMERSGPGTRYGPLGPLDPSARF*
Coding >Agabi119p4|044500
ATGGCCCTTCGTTTCCAGGCAAATCCCCATGTCTCTGATGTCCCCATACCCACGGCACGACAACCCCACCTTTCT
GGTGCAACCGTCCGACGAGCGAAAACCTTGACTCGGCCTGAGCGAGGGGTCGCTCCTGTCCCACTAATTAATCCA
CCCGCGGTCTCCTCTTCGACGCCAGATGTTGCTATCTACAATGGCTCAATATCTTGGAGAATATTTTCCCGTATT
ATTACTTTGTGGGCACCCGATTTTCTCTTGAGTTCAATTGGTGGAATGAAGGATTCGAACGTGAGACAGGCGTGG
AGGGAAAAAATAGGTCTCTGTGCCATAATTGCAGTTCTCTGCGCCGCTGTGGGGTTTGCAACAGTTGGTTTTCAG
AAAGTGCTATGCCCTGAAAATGCAAACTCCAATGCGCGGTTCCTCGATGTAGGAGCGACGCCGGGAACGCTTGGC
ATTCAAGGTGTCATGTACAATGTCTCTTCCGCTCGTTCCGTCAATGGCGTTGACCTATTACGCCTTTCTCAGTCC
CCTGGATTGGACATCACGACCTACTTTCAACGCGACGCATCACAGTTCAAGTCATGTCAAGGCTTGAACTTCCGG
GTTGCTCTGGATCCACCTTGTCCTTCCGCTACTCAGTGTACTCTCCCCCCCATCAACTCCTCGACCTTTCAGTCA
CTCTCAATCTTCGACACAGGATTTCTAGCTGGTTATTCATGGGATCAGGTTTCTTCTCTGCGCAATTATTTTGTG
CTTGATGGCGCTGTTCTTAACATGGCCCCTTATTTCGCACTCCACTCTCAGGAGGTACCCAACGATAGCGTTGAC
AGAGCTTTACGTACTGTTTTGCAACAGCAGTTGATCGGTGCCGGAAAGGATGGCACACGGTTGTTCTTCAATCGA
GCCGATCTCAAGTCGGTCGTTCCTTGTCTAAAGGAGCGTTACTATGCAGGGAACATCGACAAAGTGACCCCAGGC
TGCTTCGTGTCCTCATTATTTCTGTATACTGGCCTCATTGTTATTCTCGGCCTCGTTTTCGTCCGTTTTGTCATG
GCGTGTGTTTTCAATTGGTTCATGTCAGAACGCTTGGCGGACACGCCGACAAGTCAGGATCTCAGCCGCTCAGCT
ATTAGTCCTGCTGTCATGCCAGGAGATGCCAATATTTCGGTCAACAACAAGAGTGGAACGGCTCCTTGGGCCAAC
GACGTCAGCAAAAAGCTTCAAAGAGGACCCAAATCAATCGCTTCAAATTCTAGTGCGACGCTGACGAATTCTGAC
GGTTCAACGCCAATTATGAGCTTGGCTCAAATTGGTGCAGAGCTTTTTGCTGTGTGCCTCGTCACGTGTTATTCC
GAAGGTGAAGAGTCACTACGCACTACTCTTGACTCGATATCTGCTACGACGTATTCGGATGCCAGGAAGTTATTA
TTTGTTGTTGCGGATGGTATGATTACAGGCGCGGGAGAGAAGCGCAGCACTCCAGATATTTGTGTTAGTCTCTTG
GAAGCGGACCCGCGGTTTGGTAACCCAATTTCTATGACCTACAATGCGGTTGGTTCAGGTGCTAAGGCTCAAAAT
CGAGCTATGGTTTATGCAGGACACTATACTGTTGCTGGTCGACGTACACCGATGGTCATTGTCGTTAAATGTGGC
ACTGAACGTGAGGCTGCTACTGACAAGAAGCCAGGAAATCGTGGCAAACGTGACAGTCAACTTATTCTTATGAAC
TTTTTCTCTCGTGTCACATATAATGACCGGATGACCCCTCTTGATTTCGACCTCTTCCGCAAAATCCATGCCCTA
ATGGGTGTAACTCCCGATTTCTTTGAAGTCTGTTTGATGGTGGATGCTGATACCAAGGTCTTCCCCGAATCCCTG
GGTTACCTGGTCAACTGTATGCATCATGACCAAATGATAATGGGTGTTTGTGGTGAAACCCGTATCGCCAACAAG
CGTCAATCTTGGGTAACGGCTATACAGGTGTTCGAATACTTTATCTCGCATCACCTCGCTAAAGCATTCGAGCTC
AAGGCTCGAAAGTCAACTGGAGATGATTGGGTTCCCTTAATCGTTAAACCCGAAATCGTCAAGGAGTATAGTCAA
AGTGAAGTCACCACTTTGCACCAAAAAAATCTTCTTTTGCTTGGCGAAGATCGGTTCCTCACCACCATCCTTCTT
CGAACTTTTCCTAATCGCAAAATGATGTTTCTTCCTCAAGCTCGTTGCCGAACCATCGTACCCGATACCTTCAAG
GTATTGTTATCGCAGCGCCGGCGCTGGATTAACTCCACTATTCACAATCTCATGGAGCTCGTTTTGGTTCGGAAT
CTATGCGGCACTTTCTGCTTCAGCATGCAGTTCGTCGTATTCATGGACCTTTTAGGTACTGTGGTTCTTCCCATT
GCCATTGCACTTACCTATTCCCTTATCATTGGAATGGGGTTCAATCCGCCAAAAACATTCGAGGAAGCGATTCCC
CTTATGCTACTGATCGCCGTCCTTGGACTTCCAGCAATTCTTATTCTCCTCACTACTCGCAAACTCATATATGTC
TTCTGGATGTTGATTTATCTTTTTGCTTTGCCCGTTTGGAATTTTGTCCTCCCTATCTATGCTTTCTGGCACTTT
GATGACTTTTCTTGGGGTCAAACTCGGAAGATCGAGGGCGAAGCCAAAGGGGAAGGCCATGGAGATGAGGGAGGG
AAAAACATGAGTCCATCTGTTCCCATGCGTCGTTGGGAAGATTGGGAGAGATCACGTTTGCGAAAGCTTCGACGC
GAAGAGCGTCGGCGAAGGGATTTCGAACGAGCCCATCCCTCAGGGTACTTCGCTGGAGATGGCGATCTCCTCAGC
GTCCGGACAGATACTCGTAGCCAATACGATGGATCCGATACACTTTCTATTGGCTCTTCCGATGATGATCATTGG
GGCCCTCAAATTGGCGGTTATAATGAACATAACGCACAGAATCCACTGCCACCTGTTAGTTTGCACGTACCGAAC
CAGGCTCTACAGAATGCGAAGACTTTCAACAATGCCGAACTGGAGGCTATGTTAGAAAGCGGATTTGATGACCGG
CCAACCCCTCCCACTTCAACTTATGCTCCTCGGTATCAGCTATCTGATACAGGATCTTCTACTCAACTAGCAGGT
GTGGCAGGAAATGGGTATGCTCCTTTAACCCGGGCAACTTCCCCTGGCCTTGGTCATGCCCCCTCATCTATCAGT
CATACGCTATCCCCGACATCACCAACGATCTTTCCGGGTGAAGTACCAAAGTCCATGGAGCGCAGTGGTCCTGGC
ACGCGATACGGTCCTTTAGGTCCTTTAGATCCCTCCGCGAGATTTTGA
Transcript >Agabi119p4|044500
ATGGCCCTTCGTTTCCAGGCAAATCCCCATGTCTCTGATGTCCCCATACCCACGGCACGACAACCCCACCTTTCT
GGTGCAACCGTCCGACGAGCGAAAACCTTGACTCGGCCTGAGCGAGGGGTCGCTCCTGTCCCACTAATTAATCCA
CCCGCGGTCTCCTCTTCGACGCCAGATGTTGCTATCTACAATGGCTCAATATCTTGGAGAATATTTTCCCGTATT
ATTACTTTGTGGGCACCCGATTTTCTCTTGAGTTCAATTGGTGGAATGAAGGATTCGAACGTGAGACAGGCGTGG
AGGGAAAAAATAGGTCTCTGTGCCATAATTGCAGTTCTCTGCGCCGCTGTGGGGTTTGCAACAGTTGGTTTTCAG
AAAGTGCTATGCCCTGAAAATGCAAACTCCAATGCGCGGTTCCTCGATGTAGGAGCGACGCCGGGAACGCTTGGC
ATTCAAGGTGTCATGTACAATGTCTCTTCCGCTCGTTCCGTCAATGGCGTTGACCTATTACGCCTTTCTCAGTCC
CCTGGATTGGACATCACGACCTACTTTCAACGCGACGCATCACAGTTCAAGTCATGTCAAGGCTTGAACTTCCGG
GTTGCTCTGGATCCACCTTGTCCTTCCGCTACTCAGTGTACTCTCCCCCCCATCAACTCCTCGACCTTTCAGTCA
CTCTCAATCTTCGACACAGGATTTCTAGCTGGTTATTCATGGGATCAGGTTTCTTCTCTGCGCAATTATTTTGTG
CTTGATGGCGCTGTTCTTAACATGGCCCCTTATTTCGCACTCCACTCTCAGGAGGTACCCAACGATAGCGTTGAC
AGAGCTTTACGTACTGTTTTGCAACAGCAGTTGATCGGTGCCGGAAAGGATGGCACACGGTTGTTCTTCAATCGA
GCCGATCTCAAGTCGGTCGTTCCTTGTCTAAAGGAGCGTTACTATGCAGGGAACATCGACAAAGTGACCCCAGGC
TGCTTCGTGTCCTCATTATTTCTGTATACTGGCCTCATTGTTATTCTCGGCCTCGTTTTCGTCCGTTTTGTCATG
GCGTGTGTTTTCAATTGGTTCATGTCAGAACGCTTGGCGGACACGCCGACAAGTCAGGATCTCAGCCGCTCAGCT
ATTAGTCCTGCTGTCATGCCAGGAGATGCCAATATTTCGGTCAACAACAAGAGTGGAACGGCTCCTTGGGCCAAC
GACGTCAGCAAAAAGCTTCAAAGAGGACCCAAATCAATCGCTTCAAATTCTAGTGCGACGCTGACGAATTCTGAC
GGTTCAACGCCAATTATGAGCTTGGCTCAAATTGGTGCAGAGCTTTTTGCTGTGTGCCTCGTCACGTGTTATTCC
GAAGGTGAAGAGTCACTACGCACTACTCTTGACTCGATATCTGCTACGACGTATTCGGATGCCAGGAAGTTATTA
TTTGTTGTTGCGGATGGTATGATTACAGGCGCGGGAGAGAAGCGCAGCACTCCAGATATTTGTGTTAGTCTCTTG
GAAGCGGACCCGCGGTTTGGTAACCCAATTTCTATGACCTACAATGCGGTTGGTTCAGGTGCTAAGGCTCAAAAT
CGAGCTATGGTTTATGCAGGACACTATACTGTTGCTGGTCGACGTACACCGATGGTCATTGTCGTTAAATGTGGC
ACTGAACGTGAGGCTGCTACTGACAAGAAGCCAGGAAATCGTGGCAAACGTGACAGTCAACTTATTCTTATGAAC
TTTTTCTCTCGTGTCACATATAATGACCGGATGACCCCTCTTGATTTCGACCTCTTCCGCAAAATCCATGCCCTA
ATGGGTGTAACTCCCGATTTCTTTGAAGTCTGTTTGATGGTGGATGCTGATACCAAGGTCTTCCCCGAATCCCTG
GGTTACCTGGTCAACTGTATGCATCATGACCAAATGATAATGGGTGTTTGTGGTGAAACCCGTATCGCCAACAAG
CGTCAATCTTGGGTAACGGCTATACAGGTGTTCGAATACTTTATCTCGCATCACCTCGCTAAAGCATTCGAGCTC
AAGGCTCGAAAGTCAACTGGAGATGATTGGGTTCCCTTAATCGTTAAACCCGAAATCGTCAAGGAGTATAGTCAA
AGTGAAGTCACCACTTTGCACCAAAAAAATCTTCTTTTGCTTGGCGAAGATCGGTTCCTCACCACCATCCTTCTT
CGAACTTTTCCTAATCGCAAAATGATGTTTCTTCCTCAAGCTCGTTGCCGAACCATCGTACCCGATACCTTCAAG
GTATTGTTATCGCAGCGCCGGCGCTGGATTAACTCCACTATTCACAATCTCATGGAGCTCGTTTTGGTTCGGAAT
CTATGCGGCACTTTCTGCTTCAGCATGCAGTTCGTCGTATTCATGGACCTTTTAGGTACTGTGGTTCTTCCCATT
GCCATTGCACTTACCTATTCCCTTATCATTGGAATGGGGTTCAATCCGCCAAAAACATTCGAGGAAGCGATTCCC
CTTATGCTACTGATCGCCGTCCTTGGACTTCCAGCAATTCTTATTCTCCTCACTACTCGCAAACTCATATATGTC
TTCTGGATGTTGATTTATCTTTTTGCTTTGCCCGTTTGGAATTTTGTCCTCCCTATCTATGCTTTCTGGCACTTT
GATGACTTTTCTTGGGGTCAAACTCGGAAGATCGAGGGCGAAGCCAAAGGGGAAGGCCATGGAGATGAGGGAGGG
AAAAACATGAGTCCATCTGTTCCCATGCGTCGTTGGGAAGATTGGGAGAGATCACGTTTGCGAAAGCTTCGACGC
GAAGAGCGTCGGCGAAGGGATTTCGAACGAGCCCATCCCTCAGGGTACTTCGCTGGAGATGGCGATCTCCTCAGC
GTCCGGACAGATACTCGTAGCCAATACGATGGATCCGATACACTTTCTATTGGCTCTTCCGATGATGATCATTGG
GGCCCTCAAATTGGCGGTTATAATGAACATAACGCACAGAATCCACTGCCACCTGTTAGTTTGCACGTACCGAAC
CAGGCTCTACAGAATGCGAAGACTTTCAACAATGCCGAACTGGAGGCTATGTTAGAAAGCGGATTTGATGACCGG
CCAACCCCTCCCACTTCAACTTATGCTCCTCGGTATCAGCTATCTGATACAGGATCTTCTACTCAACTAGCAGGT
GTGGCAGGAAATGGGTATGCTCCTTTAACCCGGGCAACTTCCCCTGGCCTTGGTCATGCCCCCTCATCTATCAGT
CATACGCTATCCCCGACATCACCAACGATCTTTCCGGGTGAAGTACCAAAGTCCATGGAGCGCAGTGGTCCTGGC
ACGCGATACGGTCCTTTAGGTCCTTTAGATCCCTCCGCGAGATTTTGA
Gene >Agabi119p4|044500
ATGGCCCTTCGTTTCCAGGCAAATCCCCATGTCTCTGATGTCCCCATACCCACGGCACGACAACCCCACCTTTCT
GGTGCAACCGTCCGACGAGCGAAAACCTTGACTCGGCCTGAGCGAGGGGTCGCTCCTGTCCCACTAATTAATCCA
CCCGCGGTCTCCTCTTCGACGCCAGATGTTGCTATCTACAATGGCTCAATATCTTGGAGAATATTTTCCCGTATT
ATTACTTTGTGGGCACCCGATTTTCTCTTGAGTTCAATTGGTGGAATGAAGGATTCGAACGTGAGACAGGCGTGG
AGGGAAAAAATAGGTCTCTGTGCCATAATTGCAGTTCTCTGCGCCGCTGTGGGGTTTGCAACAGTTGGTTTTCAG
AAAGTGCTATGCCCTGAAAATGCAAACTCCAATGCGCGGTTCCTCGATGTAGGAGCGACGCCGGGAACGCTTGGC
ATTCAAGGTGTCATGTACAATGTCTCTTCCGCTCGTTCCGTCAATGGCGTTGACCTATTACGCCTTTCTCAGTCC
CCTGGATTGGACATCACGACCTACTTTCAACGCGACGCATCACAGTTCAAGTCATGTCAAGGCTTGAACTTCCGG
GTTGCTCTGGATCCACCTTGTCCTTCCGCTACTCAGTGTACTCTCCCCCCCATCAACTCCTCGACCTTTCAGTCA
CTCTCAATCTTCGACACAGGATTTCTAGCTGGTTATTCATGGGATCAGGTTTCTTCTCTGCGCAATTATTTTGTG
CTTGATGGCGCTGTTCTTAACATGGCCCCTTATTTCGCACTCCACTCTCAGGAGGTACCCAACGATAGCGTTGAC
AGAGCTTTACGTACTGTTTTGCAACAGCAGTTGATCGGTGCCGGAAAGGATGGCACACGGTTGTTCTTCAATCGA
GCCGATCTCAAGTCGGTCGTTCCTTGTCTAAAGGAGCGTTACTATGCAGGGAACATCGACAAAGTGACCCCAGGC
TGCTTCGTGTCCTCATTATTTCTGTATACTGGCCTCATTGTTATTCTCGGCCTCGTTTTCGTCCGTTTTGTCATG
GCGTGTGTTTTCAATTGGTTCATGTCAGAACGCTTGGCGGACACGCCGACAAGTCAGGATCTCAGCCGCTCAGCT
ATTAGTCCTGCTGTCATGCCAGGAGATGCCAATATTTCGGTCAACAACAAGAGTGGAACGGCTCCTTGGGCCAAC
GACGTCAGCAAAAAGCTTCAAAGAGGACCCAAATCAATCGCTTCAAATTCTAGTGCGACGCTGACGAATTCTGAC
GGTTCAACGCCAATTATGAGCTTGGCTCAAATTGGTGCAGAGCTTTTTGCTGTGTGCCTCGTCACGTGTTATTCC
GAAGGTGAAGAGTCACTACGCACTACTCTTGACTCGATATCTGCTACGACGTATTCGGATGCCAGGAAGTTATTA
TTTGTTGTTGCGGATGGTATGATTACAGGCGCGGGAGAGAAGCGCAGCACTCCAGATATTTGTGTTAGTCTCTTG
GAAGCGGACCCGCGGTTTGGTAACCCAATTTCTATGACCTACAATGCGGTTGGTTCAGGTGCTAAGGCTCAAAAT
CGAGCTATGGTTTATGCAGGACACTATAGTGAGTTAATCTGCGTCTTTACACTGTGCTGCGTCACTCACATTGAT
CAAGCTGTTGCTGGTCGACGTACACCGATGGTCATTGTCGTTAAATGTGGCACTGAACGTGAGGCTGCTACTGAC
AAGAAGCCAGGAAATCGTGGCAAACGTGACAGTCAACTTATTCTTATGAACTTTTTCTCTCGTGTCACATATAAT
GACCGGATGACCCCTCTTGATTTCGACCTCTTCCGCAAAATCCATGCCCTAATGGGTGTAACTCCCGATTTCTTT
GAAGTCTGTTTGATGGTCTGTAGTTTGGAATTAAAATTTTATTGATCTGACAAGACCATTCTAGGTGGATGCTGA
TACCAAGGTCTTCCCCGAATCCCTGGGTTACCTGGTCAACTGTATGCATCATGACCAAATGATAATGGGTGTTTG
TGGTGAAACCCGTATCGCCAACAAGCGTCAATCTTGGGTAACGGCTATACAGGTGTTCGAATACTTTATCTCGCA
TCACCTCGCTAAAGCATTCGAGTCCGTTTTCGGTGGTGTTTCTTGTCTGCCTGGGTGCTTCTCCATGTTCAGGCT
CAAGGCTCGAAAGTCAACTGGAGATGATTGGGTTCCCTTAATCGTTAAACCCGAAATCGTCAAGGAGTATAGTCA
AAGTGAAGTCACCACTTTGCACCAAAAAAATCTTCTTTTGCTTGGCGAAGATCGGTTCCTCACCACCATCCTTCT
TCGAACTTTTCCTAATCGCAAAATGATGTTTCTTCCTCAAGCTCGTTGCCGAACCATCGTACCCGATACCTTCAA
GGTATTGTTATCGCAGCGCCGGCGCTGGATTAACTCCACTATTCACAATCTCATGGAGCTCGTTTTGGTTCGGAA
TCTATGCGGCACTTTCTGCTTCAGCATGCAGTTCGTCGTATTCATGGACCTTTTAGGTACTGTGGTTCTTCCCAT
TGCCATTGCACTTACCTATTCCCTTATCATTGGAATGGGGTTCAATCCGCCAAAAACATTCGAGGAAGCGATTCC
CCTTATGCTACTGATCGCCGTCCTTGGACTTCCAGCAATTCTTATTCTCCTCACTACTCGCAAACTCATATATGT
CTTCTGGATGTTGATTTATCTTTTTGCTTTGCCCGTTTGGAATTTTGTCCTCCCTATCTATGCTTTCTGGCACTT
TGATGACTTTTCTTGGGGTCAAACTCGGTGAGTCGTCTATAATAAACCTAACACGATACTTACATCCTGTGCAGG
AAGATCGAGGGCGAAGCCAAAGGGGAAGGCCATGGAGATGAGGGAGGGAAAAACATGAGTCCATCTGTTCCCATG
CGTCGTTGGGAAGATTGGGAGAGATCACGTTTGCGAAAGCTTCGACGCGAAGAGCGTCGGCGAAGGGATTTCGAA
CGAGCCCATCCCTCAGGGTACTTCGCTGGAGATGGCGATCTCCTCAGCGTCCGGACAGATACTCGTAGCCAATAC
GATGGATCCGATACACTTTCTATTGGCTCTTCCGATGATGATCATTGGGGCCCTCAAATTGGCGGTTATAATGAA
CATAACGCACAGAATCCACTGCCACCTGTTAGTTTGCACGTACCGAACCAGGCTCTACAGAATGCGAAGACTTTC
AACAATGCCGAACTGGAGGCTATGTTAGAAAGCGGATTTGATGACCGGCCAACCCCTCCCACTTCAACTTATGCT
CCTCGGTATCAGCTATCTGATACAGGATCTTCTACTCAACTAGCAGGTGTGGCAGGAAATGGGTATGCTCCTTTA
ACCCGGGCAACTTCCCCTGGCCTTGGTCATGCCCCCTCATCTATCAGTCATACGCTATCCCCGACATCACCAACG
ATCTTTCCGGGTGAAGTACCAAAGTCCATGGAGCGCAGTGGTCCTGGCACGCGATACGGTCCTTTAGGTCCTTTA
GATCCCTCCGCGAGATTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail