Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|044490
Gene name
Locationscaffold_02:1350332..1356803
Strand-
Gene length (bp)6471
Transcript length (bp)5166
Coding sequence length (bp)5166
Protein length (aa) 1722

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12449 DUF3684 Protein of unknown function (DUF3684) 0.0E+00 198 1277

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9JLC8|SACS_MOUSE Sacsin OS=Mus musculus GN=Sacs PE=1 SV=2 23 143 4.0E-08
sp|Q9NZJ4|SACS_HUMAN Sacsin OS=Homo sapiens GN=SACS PE=1 SV=2 23 143 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|044490
MASRDSLWESGYDESVEVNQRALIDKVLARYSGEFTVFRELLQNSDDAQSQTVEIRFQTQGFIEGESLPGTDNQT
TDLPSLETTPVHQWIFRNNGISFTSEDWSRLKKIAEGNPDEQKIGAFGVGFYSLFSITEEPFVKSGDQWMGFYWK
DKKDQLFARRGKLDDNRLSSWTSFEMVLREPSPIPPAFDLTRFLTSSITFMTHLQEISVYFDNWCLLTLKKAVGI
PQLHQLPRVLSLTSPTKYMSVSNLKEIPVTIQATVMNWIYTSNTESRKKLLPKPVKAVATSFFSSLFGSLASNST
PQRQSVSLPPVIPQIDPLGTSETSIILSVFSADIKVKLDSKLSSEIHRSTKKRPPSTMKYELIYTAKDKYDASKQ
EEAKYPHATGSVFQGLRADLEGLGSTRIFIGHATAQTTGIGGHMAARFIPTVEREAIDFMDRHVAVWNRELLYVG
GLLSRAAYQIEIEAVHKIWEANAEMFQGAILPELQSSLTSRATHALRFFTFHPSTPSAEVSVLLENAFFSSGPFN
GLPLISTLGIRNAPQIRLPDPSLTFLKRLPMVPDELVSEPMVLSMHSKGVIKAVTFEDVLDELRARPLPEDDMVA
CIKWWISNYNISNAAHLTSVRKQLIDAAVLSIFPTSGEEKIIPLHSIKTVLNQRLLNGLPSDGPLPTHVLPLSIA
KHFSLDDLKRACSWADLTITDWLDHICDPAVASANSTYNIESSPHWAEKVLSFVARNWVNGISSINKQHVIILLK
AKTCIPTSNGMKRPDESYFSSADIFHDLSTVRLPSGNPVKGSIEKLLQDLEVRKHVELQLIFNRMIKTNEWTIND
LTTYLVSVKSSLKEEEMRRLKLTAAFPREHSAALGDVEPKPQRLKADQLYEPLPVFRQLALPVIDWGMQSKWRSS
SDEAHFLFDLGLRRYPPLQELIQLCMNSDAEIRSTALRYLIDNLRTKYSHYNASDYQDAEFIPALDGTKSCLGSP
RQVFSKSEWSQLGFLVVDPKLQADSAKLQIKEQPTASQLVGLLQTKPPDSPEQGEKWFSALSTRVPEFSRSELSR
LSETRFIPVYTPAGAIGPTMRWLLPTQCYLGRQSKEKFHSKLFIFVDFGQAGNTFLIACGARQEPSVEELAKILL
DDPRRFYELAEGPTNFLNEIRNIAVNRKNLSTVTVSRMKKAPILICSQRKHAEQSHPVGGEPDDEEWEVAYDLNI
ADRIIIADDTNAHRVFGADLFTAPQEDMIEAFYMELGARRLSSLVKEEYLLGGEIPNSRRARDTRSLILERLPIF
LHEHNHAHTKVSLDWLQAEANFNVKSYGQIKVKKVLTYGKLHIERSQEASAVAKRSASQGIDLLLADNAETDMYE
VAMCLIRFIFEYPKAHDALLFMTILSTDLKALKRRGYNVDRILRQRKLAKQAAEVRVLEENGNSISEASSKVKEM
TSLSSTSLAPIPDVHEPSNRPSSSFSDALQMLKRKVGVAGDQISHNQGLNAVRKPERPSMMHAGDSTSEALIPGG
MPGGPFGGPLPQPSKREDNLSAASLQNIASNIDVAIRSCRAESSNLLQNRQEMRYVKESNNDGYCDISGHAQNMI
LVGSVEQVKIFVGQDVSGDEGKGIITKKSGVISRFIRIMASLAHVYYLNITNLHIFYDTEGVLIAFNRNGSIFLN
LRYYEAWHDIAVQQGHAENALISWYFTIAHEIAHNLVQPHNSEHEFYFSAICEKHLVSLSKLIIENGGNIK*
Coding >Agabi119p4|044490
ATGGCGTCTAGAGACTCACTGTGGGAGAGTGGTTACGATGAATCCGTCGAGGTCAATCAACGTGCATTAATTGAC
AAAGTACTCGCGCGGTATTCCGGAGAATTCACCGTTTTTCGAGAGCTTCTACAAAACTCAGATGATGCCCAATCT
CAAACTGTCGAAATTCGGTTCCAAACACAGGGTTTCATCGAGGGGGAAAGTCTGCCTGGAACGGACAATCAAACA
ACTGACTTACCCAGCCTTGAGACTACGCCTGTCCATCAATGGATATTCAGAAACAACGGCATTTCATTCACCAGC
GAGGACTGGAGTCGTCTCAAGAAGATCGCCGAAGGAAACCCAGATGAACAGAAGATCGGTGCTTTCGGGGTCGGC
TTTTACAGTCTCTTTTCTATCACCGAAGAGCCTTTTGTCAAATCCGGAGATCAATGGATGGGTTTTTATTGGAAA
GACAAGAAGGACCAATTGTTTGCTCGTCGCGGCAAGCTCGATGATAACCGCCTGTCGTCATGGACAAGCTTTGAA
ATGGTCCTCCGAGAACCGTCTCCGATTCCTCCAGCATTTGACCTCACCCGATTCCTTACCTCGTCCATCACATTC
ATGACCCATCTTCAAGAAATTTCCGTGTACTTCGATAACTGGTGTCTTTTAACACTCAAGAAGGCGGTTGGAATA
CCCCAGTTACATCAACTGCCTCGTGTGTTGTCTCTGACGAGTCCGACAAAGTATATGTCGGTTAGTAATTTGAAG
GAAATACCTGTAACAATCCAAGCCACTGTGATGAATTGGATATATACCTCTAACACCGAGTCGCGGAAAAAGTTG
CTTCCAAAGCCAGTCAAGGCGGTCGCGACCAGTTTCTTTTCGTCATTGTTCGGATCCCTTGCTAGTAATTCTACG
CCCCAAAGGCAATCAGTGTCTCTTCCCCCAGTCATACCTCAAATTGATCCTCTTGGAACTTCGGAAACGAGTATA
ATACTTTCGGTATTCTCTGCGGATATTAAGGTCAAACTGGACTCGAAGCTCTCTTCAGAAATACATCGATCTACT
AAGAAAAGGCCTCCATCTACTATGAAATATGAATTAATATATACTGCAAAAGATAAATATGATGCAAGTAAACAA
GAAGAAGCAAAGTATCCGCATGCAACAGGCAGTGTTTTCCAAGGTCTACGTGCTGATCTCGAAGGGCTTGGATCC
ACGCGAATTTTTATCGGACATGCAACTGCTCAAACAACGGGGATTGGAGGCCATATGGCGGCTCGATTCATCCCG
ACCGTGGAAAGAGAAGCGATAGACTTCATGGACCGACATGTTGCAGTCTGGAACAGGGAGCTTCTTTATGTTGGA
GGCCTTTTATCTCGTGCGGCATATCAGATAGAGATCGAGGCGGTACACAAGATATGGGAGGCTAACGCAGAAATG
TTCCAAGGCGCCATTCTACCCGAATTGCAATCTTCTTTGACTAGTAGAGCAACACACGCACTCAGATTCTTTACC
TTTCACCCTTCAACTCCATCTGCAGAGGTTTCTGTTCTACTTGAAAATGCTTTCTTCAGCTCTGGCCCCTTCAAT
GGTCTTCCTCTCATTTCAACTCTAGGTATACGTAATGCTCCTCAAATTCGCTTACCTGACCCCTCCCTAACTTTC
CTCAAACGGCTGCCCATGGTACCTGACGAGCTTGTGTCCGAACCCATGGTCCTATCGATGCACAGCAAAGGCGTA
ATCAAGGCAGTCACCTTTGAAGACGTTTTGGACGAACTCAGAGCAAGGCCTCTACCTGAAGATGATATGGTTGCC
TGCATCAAATGGTGGATATCCAATTACAATATCAGTAATGCCGCGCACCTCACTTCCGTGAGGAAGCAGCTGATT
GACGCCGCTGTGTTATCGATCTTCCCCACTTCAGGCGAAGAAAAAATCATTCCGCTTCACAGCATAAAGACAGTC
CTTAACCAAAGGCTCTTGAACGGCTTACCATCGGATGGGCCTCTTCCTACTCACGTTCTTCCACTATCAATTGCA
AAACACTTCTCTCTTGACGACTTGAAGCGCGCTTGCTCCTGGGCGGATCTTACGATCACTGATTGGTTGGATCAT
ATATGTGACCCCGCTGTTGCAAGTGCAAATTCTACCTATAACATAGAATCTTCGCCTCACTGGGCAGAGAAAGTC
TTATCATTTGTGGCAAGGAACTGGGTCAATGGAATATCCTCAATCAACAAGCAGCACGTCATAATTCTGTTGAAG
GCCAAAACGTGCATTCCAACTTCAAATGGAATGAAGCGTCCAGATGAATCGTATTTTTCGAGCGCTGATATATTT
CACGACTTGTCCACCGTCAGACTTCCTTCTGGAAATCCCGTCAAAGGCTCCATAGAAAAATTGCTTCAGGACTTA
GAGGTGCGGAAGCATGTCGAACTCCAATTGATTTTTAATCGAATGATCAAAACGAATGAGTGGACAATAAATGAC
CTTACTACGTACTTGGTTTCAGTTAAATCAAGCCTCAAAGAAGAAGAAATGAGACGGCTCAAGCTCACTGCCGCT
TTCCCGAGGGAGCACTCGGCAGCACTTGGCGACGTAGAACCCAAGCCTCAGCGTCTTAAAGCAGATCAATTATAT
GAGCCATTACCTGTGTTCCGTCAACTTGCGCTTCCTGTCATTGACTGGGGTATGCAATCAAAGTGGCGAAGTAGT
TCAGATGAAGCCCATTTCCTATTTGATTTGGGATTGCGCCGCTATCCTCCCCTTCAGGAGTTGATCCAACTTTGT
ATGAATTCCGATGCAGAAATCCGCTCGACAGCCCTCCGATATCTCATAGATAATCTGCGCACTAAGTACTCCCAT
TACAATGCAAGCGATTATCAAGATGCTGAGTTCATTCCCGCCCTTGATGGTACCAAAAGCTGTTTAGGTTCTCCC
CGCCAAGTTTTCTCTAAATCGGAGTGGTCCCAGCTGGGATTCCTAGTGGTTGATCCTAAACTACAGGCTGACTCA
GCAAAACTTCAAATCAAGGAGCAACCTACAGCTAGTCAGCTCGTCGGTTTATTGCAGACGAAACCTCCTGACAGC
CCGGAACAAGGAGAGAAATGGTTTAGCGCTTTATCGACTCGCGTCCCCGAGTTTTCGCGTTCTGAACTTTCAAGA
CTATCTGAAACTCGATTTATTCCGGTATATACTCCAGCAGGAGCGATTGGACCAACTATGCGCTGGTTGTTACCC
ACACAGTGTTATCTGGGGCGACAATCAAAGGAAAAATTTCATTCAAAGCTCTTCATCTTTGTCGATTTTGGTCAA
GCAGGTAACACCTTTCTAATCGCTTGTGGTGCAAGGCAAGAGCCAAGCGTGGAAGAACTCGCAAAAATACTTTTG
GACGATCCCCGTCGCTTCTACGAGTTAGCAGAAGGACCTACAAATTTCCTTAATGAGATACGAAATATTGCCGTC
AACCGAAAGAATCTATCGACTGTCACTGTATCCAGGATGAAAAAGGCACCAATACTCATATGCTCCCAACGCAAA
CATGCTGAGCAGTCGCACCCTGTCGGTGGTGAACCGGATGATGAAGAATGGGAGGTGGCTTACGATTTGAACATC
GCTGATCGTATAATCATTGCTGATGACACCAATGCACACCGAGTCTTTGGCGCAGATTTATTTACTGCGCCACAA
GAAGATATGATTGAAGCATTCTACATGGAACTGGGGGCTCGCAGACTGAGCTCTTTGGTCAAGGAAGAGTACCTT
CTAGGAGGAGAAATTCCCAACTCCAGGCGCGCCAGAGACACTCGTAGCCTGATTTTAGAACGGCTTCCTATCTTT
CTGCACGAGCACAATCATGCGCATACAAAGGTGTCATTAGATTGGCTTCAAGCTGAAGCCAATTTTAATGTTAAA
TCCTATGGTCAAATCAAGGTTAAAAAAGTGCTAACCTATGGGAAACTACACATTGAACGAAGCCAGGAAGCATCC
GCCGTTGCCAAAAGGAGCGCATCTCAGGGAATCGATCTGTTACTAGCTGACAACGCCGAAACCGATATGTACGAG
GTAGCAATGTGCCTTATTCGATTTATTTTCGAATACCCTAAAGCGCACGATGCCTTGTTATTCATGACTATCCTG
TCAACCGATCTTAAAGCCCTCAAAAGGCGTGGCTACAACGTTGACCGCATTCTTCGTCAAAGAAAGCTTGCAAAG
CAAGCTGCAGAAGTACGCGTACTGGAAGAAAACGGCAATTCAATTTCGGAAGCTTCTTCAAAAGTGAAAGAGATG
ACATCACTTTCTTCAACATCTCTCGCGCCGATACCTGACGTTCATGAGCCGTCAAATAGACCATCCTCTTCGTTT
TCCGATGCTTTACAAATGTTAAAGCGGAAAGTTGGTGTTGCCGGGGATCAGATCTCACACAACCAGGGTTTGAAT
GCCGTTCGAAAACCAGAGAGGCCGTCTATGATGCACGCGGGTGATTCAACTTCGGAAGCTCTAATCCCTGGTGGT
ATGCCGGGTGGCCCTTTTGGGGGACCACTTCCCCAACCGTCTAAAAGGGAGGACAATCTATCGGCCGCTTCGCTG
CAAAACATAGCTTCCAATATCGACGTGGCCATCAGATCTTGTCGGGCAGAGTCGAGTAATCTGTTGCAAAACCGC
CAAGAAATGCGATACGTCAAGGAAAGCAATAATGACGGCTACTGTGATATATCTGGTCATGCTCAGAATATGATA
TTAGTTGGCTCAGTGGAGCAAGTTAAGATTTTTGTTGGACAGGATGTTTCCGGCGATGAAGGAAAAGGCATAATC
ACCAAGAAGTCGGGCGTAATTTCCAGGTTTATTCGCATCATGGCCTCGCTTGCACACGTCTATTATTTAAACATC
ACGAATCTTCATATATTCTACGACACGGAAGGCGTGCTCATTGCCTTTAATAGGAATGGAAGCATCTTTTTGAAT
CTACGGTACTACGAAGCTTGGCATGACATAGCGGTTCAACAAGGGCATGCTGAAAATGCGCTTATTTCTTGGTAT
TTCACAATCGCACATGAGATTGCGCACAACCTGGTGCAACCCCACAACTCAGAACATGAATTCTACTTTTCTGCC
ATATGCGAAAAGCATCTGGTTTCGCTCTCCAAGCTGATCATAGAAAATGGCGGGAACATTAAATAG
Transcript >Agabi119p4|044490
ATGGCGTCTAGAGACTCACTGTGGGAGAGTGGTTACGATGAATCCGTCGAGGTCAATCAACGTGCATTAATTGAC
AAAGTACTCGCGCGGTATTCCGGAGAATTCACCGTTTTTCGAGAGCTTCTACAAAACTCAGATGATGCCCAATCT
CAAACTGTCGAAATTCGGTTCCAAACACAGGGTTTCATCGAGGGGGAAAGTCTGCCTGGAACGGACAATCAAACA
ACTGACTTACCCAGCCTTGAGACTACGCCTGTCCATCAATGGATATTCAGAAACAACGGCATTTCATTCACCAGC
GAGGACTGGAGTCGTCTCAAGAAGATCGCCGAAGGAAACCCAGATGAACAGAAGATCGGTGCTTTCGGGGTCGGC
TTTTACAGTCTCTTTTCTATCACCGAAGAGCCTTTTGTCAAATCCGGAGATCAATGGATGGGTTTTTATTGGAAA
GACAAGAAGGACCAATTGTTTGCTCGTCGCGGCAAGCTCGATGATAACCGCCTGTCGTCATGGACAAGCTTTGAA
ATGGTCCTCCGAGAACCGTCTCCGATTCCTCCAGCATTTGACCTCACCCGATTCCTTACCTCGTCCATCACATTC
ATGACCCATCTTCAAGAAATTTCCGTGTACTTCGATAACTGGTGTCTTTTAACACTCAAGAAGGCGGTTGGAATA
CCCCAGTTACATCAACTGCCTCGTGTGTTGTCTCTGACGAGTCCGACAAAGTATATGTCGGTTAGTAATTTGAAG
GAAATACCTGTAACAATCCAAGCCACTGTGATGAATTGGATATATACCTCTAACACCGAGTCGCGGAAAAAGTTG
CTTCCAAAGCCAGTCAAGGCGGTCGCGACCAGTTTCTTTTCGTCATTGTTCGGATCCCTTGCTAGTAATTCTACG
CCCCAAAGGCAATCAGTGTCTCTTCCCCCAGTCATACCTCAAATTGATCCTCTTGGAACTTCGGAAACGAGTATA
ATACTTTCGGTATTCTCTGCGGATATTAAGGTCAAACTGGACTCGAAGCTCTCTTCAGAAATACATCGATCTACT
AAGAAAAGGCCTCCATCTACTATGAAATATGAATTAATATATACTGCAAAAGATAAATATGATGCAAGTAAACAA
GAAGAAGCAAAGTATCCGCATGCAACAGGCAGTGTTTTCCAAGGTCTACGTGCTGATCTCGAAGGGCTTGGATCC
ACGCGAATTTTTATCGGACATGCAACTGCTCAAACAACGGGGATTGGAGGCCATATGGCGGCTCGATTCATCCCG
ACCGTGGAAAGAGAAGCGATAGACTTCATGGACCGACATGTTGCAGTCTGGAACAGGGAGCTTCTTTATGTTGGA
GGCCTTTTATCTCGTGCGGCATATCAGATAGAGATCGAGGCGGTACACAAGATATGGGAGGCTAACGCAGAAATG
TTCCAAGGCGCCATTCTACCCGAATTGCAATCTTCTTTGACTAGTAGAGCAACACACGCACTCAGATTCTTTACC
TTTCACCCTTCAACTCCATCTGCAGAGGTTTCTGTTCTACTTGAAAATGCTTTCTTCAGCTCTGGCCCCTTCAAT
GGTCTTCCTCTCATTTCAACTCTAGGTATACGTAATGCTCCTCAAATTCGCTTACCTGACCCCTCCCTAACTTTC
CTCAAACGGCTGCCCATGGTACCTGACGAGCTTGTGTCCGAACCCATGGTCCTATCGATGCACAGCAAAGGCGTA
ATCAAGGCAGTCACCTTTGAAGACGTTTTGGACGAACTCAGAGCAAGGCCTCTACCTGAAGATGATATGGTTGCC
TGCATCAAATGGTGGATATCCAATTACAATATCAGTAATGCCGCGCACCTCACTTCCGTGAGGAAGCAGCTGATT
GACGCCGCTGTGTTATCGATCTTCCCCACTTCAGGCGAAGAAAAAATCATTCCGCTTCACAGCATAAAGACAGTC
CTTAACCAAAGGCTCTTGAACGGCTTACCATCGGATGGGCCTCTTCCTACTCACGTTCTTCCACTATCAATTGCA
AAACACTTCTCTCTTGACGACTTGAAGCGCGCTTGCTCCTGGGCGGATCTTACGATCACTGATTGGTTGGATCAT
ATATGTGACCCCGCTGTTGCAAGTGCAAATTCTACCTATAACATAGAATCTTCGCCTCACTGGGCAGAGAAAGTC
TTATCATTTGTGGCAAGGAACTGGGTCAATGGAATATCCTCAATCAACAAGCAGCACGTCATAATTCTGTTGAAG
GCCAAAACGTGCATTCCAACTTCAAATGGAATGAAGCGTCCAGATGAATCGTATTTTTCGAGCGCTGATATATTT
CACGACTTGTCCACCGTCAGACTTCCTTCTGGAAATCCCGTCAAAGGCTCCATAGAAAAATTGCTTCAGGACTTA
GAGGTGCGGAAGCATGTCGAACTCCAATTGATTTTTAATCGAATGATCAAAACGAATGAGTGGACAATAAATGAC
CTTACTACGTACTTGGTTTCAGTTAAATCAAGCCTCAAAGAAGAAGAAATGAGACGGCTCAAGCTCACTGCCGCT
TTCCCGAGGGAGCACTCGGCAGCACTTGGCGACGTAGAACCCAAGCCTCAGCGTCTTAAAGCAGATCAATTATAT
GAGCCATTACCTGTGTTCCGTCAACTTGCGCTTCCTGTCATTGACTGGGGTATGCAATCAAAGTGGCGAAGTAGT
TCAGATGAAGCCCATTTCCTATTTGATTTGGGATTGCGCCGCTATCCTCCCCTTCAGGAGTTGATCCAACTTTGT
ATGAATTCCGATGCAGAAATCCGCTCGACAGCCCTCCGATATCTCATAGATAATCTGCGCACTAAGTACTCCCAT
TACAATGCAAGCGATTATCAAGATGCTGAGTTCATTCCCGCCCTTGATGGTACCAAAAGCTGTTTAGGTTCTCCC
CGCCAAGTTTTCTCTAAATCGGAGTGGTCCCAGCTGGGATTCCTAGTGGTTGATCCTAAACTACAGGCTGACTCA
GCAAAACTTCAAATCAAGGAGCAACCTACAGCTAGTCAGCTCGTCGGTTTATTGCAGACGAAACCTCCTGACAGC
CCGGAACAAGGAGAGAAATGGTTTAGCGCTTTATCGACTCGCGTCCCCGAGTTTTCGCGTTCTGAACTTTCAAGA
CTATCTGAAACTCGATTTATTCCGGTATATACTCCAGCAGGAGCGATTGGACCAACTATGCGCTGGTTGTTACCC
ACACAGTGTTATCTGGGGCGACAATCAAAGGAAAAATTTCATTCAAAGCTCTTCATCTTTGTCGATTTTGGTCAA
GCAGGTAACACCTTTCTAATCGCTTGTGGTGCAAGGCAAGAGCCAAGCGTGGAAGAACTCGCAAAAATACTTTTG
GACGATCCCCGTCGCTTCTACGAGTTAGCAGAAGGACCTACAAATTTCCTTAATGAGATACGAAATATTGCCGTC
AACCGAAAGAATCTATCGACTGTCACTGTATCCAGGATGAAAAAGGCACCAATACTCATATGCTCCCAACGCAAA
CATGCTGAGCAGTCGCACCCTGTCGGTGGTGAACCGGATGATGAAGAATGGGAGGTGGCTTACGATTTGAACATC
GCTGATCGTATAATCATTGCTGATGACACCAATGCACACCGAGTCTTTGGCGCAGATTTATTTACTGCGCCACAA
GAAGATATGATTGAAGCATTCTACATGGAACTGGGGGCTCGCAGACTGAGCTCTTTGGTCAAGGAAGAGTACCTT
CTAGGAGGAGAAATTCCCAACTCCAGGCGCGCCAGAGACACTCGTAGCCTGATTTTAGAACGGCTTCCTATCTTT
CTGCACGAGCACAATCATGCGCATACAAAGGTGTCATTAGATTGGCTTCAAGCTGAAGCCAATTTTAATGTTAAA
TCCTATGGTCAAATCAAGGTTAAAAAAGTGCTAACCTATGGGAAACTACACATTGAACGAAGCCAGGAAGCATCC
GCCGTTGCCAAAAGGAGCGCATCTCAGGGAATCGATCTGTTACTAGCTGACAACGCCGAAACCGATATGTACGAG
GTAGCAATGTGCCTTATTCGATTTATTTTCGAATACCCTAAAGCGCACGATGCCTTGTTATTCATGACTATCCTG
TCAACCGATCTTAAAGCCCTCAAAAGGCGTGGCTACAACGTTGACCGCATTCTTCGTCAAAGAAAGCTTGCAAAG
CAAGCTGCAGAAGTACGCGTACTGGAAGAAAACGGCAATTCAATTTCGGAAGCTTCTTCAAAAGTGAAAGAGATG
ACATCACTTTCTTCAACATCTCTCGCGCCGATACCTGACGTTCATGAGCCGTCAAATAGACCATCCTCTTCGTTT
TCCGATGCTTTACAAATGTTAAAGCGGAAAGTTGGTGTTGCCGGGGATCAGATCTCACACAACCAGGGTTTGAAT
GCCGTTCGAAAACCAGAGAGGCCGTCTATGATGCACGCGGGTGATTCAACTTCGGAAGCTCTAATCCCTGGTGGT
ATGCCGGGTGGCCCTTTTGGGGGACCACTTCCCCAACCGTCTAAAAGGGAGGACAATCTATCGGCCGCTTCGCTG
CAAAACATAGCTTCCAATATCGACGTGGCCATCAGATCTTGTCGGGCAGAGTCGAGTAATCTGTTGCAAAACCGC
CAAGAAATGCGATACGTCAAGGAAAGCAATAATGACGGCTACTGTGATATATCTGGTCATGCTCAGAATATGATA
TTAGTTGGCTCAGTGGAGCAAGTTAAGATTTTTGTTGGACAGGATGTTTCCGGCGATGAAGGAAAAGGCATAATC
ACCAAGAAGTCGGGCGTAATTTCCAGGTTTATTCGCATCATGGCCTCGCTTGCACACGTCTATTATTTAAACATC
ACGAATCTTCATATATTCTACGACACGGAAGGCGTGCTCATTGCCTTTAATAGGAATGGAAGCATCTTTTTGAAT
CTACGGTACTACGAAGCTTGGCATGACATAGCGGTTCAACAAGGGCATGCTGAAAATGCGCTTATTTCTTGGTAT
TTCACAATCGCACATGAGATTGCGCACAACCTGGTGCAACCCCACAACTCAGAACATGAATTCTACTTTTCTGCC
ATATGCGAAAAGCATCTGGTTTCGCTCTCCAAGCTGATCATAGAAAATGGCGGGAACATTAAATAG
Gene >Agabi119p4|044490
ATGGCGTCTAGAGACTCACTGGTAAGTGTTAGCGCTGTTTAGCTTTTCCAAACAAACCTCGAACCACCATATCTA
GTGGGAGAGTGGTTACGATGAATCCGTCGAGGTCAATCAACGTGCATTAATTGACAAAGTACTCGCGCGGTATTC
CGGAGAATTCACCGTTTTTCGAGAGCTTCTACAAAACTCAGATGATGCCCAATCTCAAACTGTCGAAATTCGGTT
CCAAACACAGGGTTTCATCGAGGGGGAAAGTCTGCCTGGAACGGACAATCAAACAACTGACTTACCCAGCCTTGA
GACTACGCCTGTATATGTTTTGTCCCTCTTCATGGTATATTGCAATGACTTTGCCTCAGGTCCATCAATGGATAT
TCAGAAACAACGGCATTTCATTCACCAGCGAGGACTGGAGTCGTCTCAAGAAGATCGGTCTGTGCATTGGTTTTT
AACACATCACTCAAATTCATGTTGTTTTTTAGCCGAAGGAAACCCAGATGAACAGAAGATCGGTGCTTTCGGGGT
CGGTACGTTGTACTTGTCTGCCTACTTAGTTCCTCTCGTTACTTATCGTACAACAAGGCTTTTACAGTCTCTTTT
CTATCACCGAAGAGCCTTTTGTCAAATCCGGAGGTACTACAGCTTTCAATAGTTTCAGCGTTGAAGATATACATC
TAAGTACCTGCAGATCAATGGATGGGTTTTTATTGGAAAGACAAGAAGGACCAAGTACGTACTAAGTAAGCATTC
TGAGAGACATATTGAAGCCACCGTCTGTCCAGTTGTTTGCTCGTCGCGGCAAGCTCGATGATAACCGCCTGTCGT
CATGGACAAGCTTTGAAATGGTCCTCCGAGAACCGTCTCCGATTCCTCCAGCATTTGACCTCACCCGATTCCTTA
CCTCGTCCATCACATTCATGACCCATCTTCAAGAAATTTCCGTGTACTTCGATAACTGGTGTCTTTTAACACTCA
AGAAGGCGGTTGGAATACCCCAGTTACATCAACTGCCTCGTGTGTTGTCTCTGACGAGTCCGACAAAGTATATGT
CGGTTAGTAATTTGAAGGAAATACGTACGCTCATTCATTAACTAATCCTGCGGCTTATTCTGACCCCGTTTTAGC
TGTAACAATCCAAGCCACTGTGATGAATTGGATATATACCTCTAACACCGAGTCGCGGAAAAAGTTGCTTCCAAA
GCCAGTCAAGGCGGTCGCGACCAGTTTCTTTTCGTCATTGTTCGGATCCCTTGCTAGTAATTCTACGCCCCAAAG
GCAATCAGTGTCTCTTCCCCCAGTCATACCTCAAATTGATCCTCTTGGAACTTCGGAAACGAGTATAATACTTTC
GGTATTCTCTGCGGATATTAAGGTCAAACTGGACTCGAAGCTCTCTTCAGAAATACATCGATCTACTAAGAAAAG
GCCTCCATCTACTATGAAATATGAATTAATATATGTGAGTTCATTCACTCATTTTTATATACAGGTCTGATACTG
CAATAGACTGCAAAAGATAAATATGATGCAAGTAAACAAGAAGAAGCAAAGTATCCGCATGCAACAGGCAGTGTT
TTCCAAGGTCTACGTGCTGATCTCGAAGGGTATGTTTGCAACCGTAGTGTCACGTTGTTTCAAGGGATTGACGGA
AGATTAGGCTTGGATCCACGCGAATTTTTATCGTAGAAATCGTCTTTTCTATTACCATTCCAGCTATCTGATCGG
CGTTTAAAGGGACATGCAACTGCTCAAACAACGGGGATTGGAGGCCATATGGCGGCTCGATTCATCCCGACCGTG
GAAAGAGAAGCGATAGACTTCATGTAAGTTTTTTTTTTTCATGTACGTGGGACCGATCGTTCAGAGAAATTCGAC
AGGGACCGACATGTTGCAGGTATGCCCCCACCCCTCGCGTTCCTGTTGTGAACATTCCCAGTTGACCTCGAGTCA
GTCTGGAACAGGGAGCTTCTTTATGTTGGAGGCCTTTTATCTCGTGCGGCATATCAGATAGAGATCGAGGCGGTA
CACAAGATATGGGAGGCTAACGCAGAAATGTTCCAAGGCGCCATTCTACCCGAATTGCAATCTTCTTTGACTAGT
AGAGCAACACACGCACTCAGATTCTTTACCTTTCACCCTTCAACTCCATCTGCAGAGGTTTCTGTTCTACTTGAA
AATGCTTTCTTCAGCTCTGGCCCCTTCAATGGTCTTCCTCTCATTTCAACTCTAGGTATACGTAATGCTCCTCAA
ATTCGCTTACCTGACCCCTCCCTAACTTTCCTCAAACGGCTGCCCATGGTACCTGACGAGCTTGTGTCCGAACCC
ATGGTCCTATCGATGCACAGCAAAGGCGTAATCAAGGCAGTCACCTTTGAAGACGTTTTGGACGAACTCAGAGCA
AGGCCTCTACCTGAAGATGATATGGTTGCCTGCATCAAATGGTGGATATCCAATTACAATATCAGTAATGCCGCG
CACCTCACTTCCGTGAGGAAGCAGCTGATTGACGCCGCTGTGTTATCGATCTTCCCCACTTCAGGCGAAGAAAAA
ATCATTCCGCTTCACAGCATAAAGACAGTCCTTAACCAAAGGCTCTTGAACGGCTTACCATCGGATGGGCCTCTT
CCTACTCACGTTCTTCCACTATCAATTGCAAAACACTTCTCTCTTGACGACTTGAAGCGCGCTTGCTCCTGGGCG
GATCTTACGATCACTGATTGGTTGGATCATATATGTGACCCCGCTGTTGCAAGTGCAAATTCTACCTATAACATA
GAATCTTCGCCTCACTGGGCAGAGAAAGTCTTATCATTTGTGGCAAGGAACTGGGTCAATGGAATATCCTCAATC
AACAAGCAGCACGTCATAATTCTGTTGAAGGCCAAAACGTGCATTCCAACTTCAAATGGAATGAAGCGTCCAGAT
GAATCGTATTTTTCGAGCGCTGATATATTTCACGACTTGTCCACCGTCAGACTTCCTTCTGGAAATCCCGTCAAA
GGCTCCATAGAAAAATTGCTTCAGGACTTAGAGGTGCGGAAGCATGTCGAACTCCAATTGATTTTTAATCGGTCA
GTATTTCCTTCGAGTCGAGAAAATCAACCTAACAGCAGGACAGAATGATCAAAACGAATGAGTGGACAATAAATG
ACCTTACTACGTACTTGGTTTCAGTTAAATCAAGCCTCAAAGAAGAAGAAATGAGACGGCTCAAGCTCACTGCCG
CTTTCCCGAGGGAGCACTCGGCAGCACTTGGCGACGTAGAACCCAAGCCTCAGCGTCTTAAAGCAGATCAATTAT
ATGAGCCATTACCTGTGTTCCGTCAACTTGCGCTTCCTGTCATTGACTGGGGTATGCAATCAAAGTGGCGAAGTA
GTTCAGATGAAGGTAGGGTTCATCAATCAATGGTCCCCATAGTGCATTCTCAACGTTTTTTGAAGCCCATTTCCT
ATTTGATTTGGGATTGCGCCGCTATCCTCCCCTTCAGGAGTTGATCCAACTTTGTATGAATTCCGATGCAGAAGT
AGGAGAGCTTCTAGCTAACACGTATCAATTGGACTCATCAAAATTAACAGATCCGCTCGACAGCCCTCCGATATC
TCATAGATAATCTGCGCACTAAGTACTCCCATTACAATGCAAGCGATTATCAAGATGCTGAGTTCATTCCCGCCC
TTGATGGTACCAAAAGCTGTTTAGGTTCTCCCCGCCAAGTTTTCTCTAAATCGGAGTGGTCCCAGCTGGGATTCC
TAGTGGTTGATCCTAAACTACAGGCTGACTCAGCAAAACTTCAAATCAAGGAGCAACCTACAGCTAGTCAGCTCG
TCGGTTTATTGCAGACGAAACCTCCTGACAGCCCGGAACAAGGAGAGAAATGGTTTAGCGCTTTATCGACTCGCG
TCCCCGGTACGCATACAAGCGTAATAGAAATAATCCATTTCTTACCATCCTCCAGAGTTTTCGCGTTCTGAACTT
TCAAGACTATCTGAAACTCGATTTATTCCGGTATATACTCCAGCAGGAGCGATTGGACCAACTATGCGCTGGTTG
TTACCCACACAGTGTTATCTGGGGCGACAATCAAAGGAAAAATTTCATTCAAAGCTCTTCATCTTTGTCGATTTT
GGTCAAGCAGGTAACACCTTTCTAATCGCTTGTGGTGCAAGGCAAGAGCCAAGCGTGGAAGAACTCGCAAAAATA
CTTTTGGACGATCCCCGTCGCTTCTACGAGTTAGCAGAAGGACCTACAAAGTGAGTATTGTTTCATTATGCTTGA
CCCTGTTATTAAAACTCCTTTGAGTTTCCTTAATGAGATACGAAATATTGCCGTCAACCGAAAGAATCTATCGAC
TGTCACTGTATCCAGGATGAAAAAGGCACCAATACTCATATGCTCCCAACGCAAACATGCTGAGCAGTCGCACCC
TGTCGGTGGTGAACCGGATGATGAAGAATGGGAGGTGGCTTACGATTTGAACATCGCTGATCGTATAATCATTGC
TGATGACACCAATGCACACCGAGTCTTTGGCGCAGATTTATTTACTGCGCCACAAGAAGATATGATTGAAGGTAT
GATATCTTAATTATAAGCAGCCAACCTAATCTCGGCGTTTGAACAGCATTCTACATGGAACTGGGGGCTCGCAGA
CTGAGCTCTTTGGTCAAGGAAGAGTACCTTCTAGGAGGAGAAATTCCCAACTCCAGGCGCGCCAGAGACACTCGT
AGCCTGATTTTAGAACGGCTTCCTATCTTTCTGCACGAGCACAATCATGCGCATACAAAGGTGTCATTAGATTGG
CTTCAAGCTGAAGCCAATTTTAATGTTAAATCCTATGGTCAAATCAAGGTTAAAAAAGTGCTAACCTATGGGAAA
CTACACATTGAACGAAGCCAGGAAGCATCCGCCGTTGCCAAAAGGAGCGCATCTCAGGGAATCGATCTGTTACTA
GCTGACAACGCCGAAACCGATATGTACGAGTAAGTCTCACCGCAGATAGTACCAACGCGATTTTTCAATCTCTTT
ACCTCTCGTGGAAAACAGGGTAGCAATGTGCCTTATTCGATTTATTTTCGAATACCCTAAAGCGCACGATGCCTT
GTTATTCATGACTATCCTGTCAACCGATCTTAAAGCCCTCAAAAGGCGTGGCTACAACGGTGCGCACACAATTCT
GTCATACCTCTTCTGATCAACCTCACGCGATTCTTAGTTGACCGCATTCTTCGTCAAAGAAAGCTTGCAAAGCAA
GCTGCAGAAGTACGCGTACTGGAAGAAAACGGCAATTCAATTTCGGAAGCTTCTTCAAAAGTGAAAGAGATGACA
TCACTTTCTTCAACATCTCTCGCGCCGATACCTGACGTTCATGAGCCGTCAAATAGACCATCCTCTTCGTTTTCC
GATGCTTTACAAATGTTAAAGCGGAAAGTTGGTGTTGCCGGGGATCAGATCTCACACAACCAGGGTTTGAATGCC
GTTCGAAAACCAGAGAGGCCGTCTATGATGCACGCGGGTGATTCAACTTCGGAAGCTCTAATCCCTGGTGGTATG
CCGGGTGGCCCTTTTGGGGGACCACTTCCCCAACCGTCTAAAAGGGAGGACAATCTATCGGCCGCTTCGCTGCAA
AACATAGGTAAGTTCCATACTCAGCATCATGAATCAAATTGATTCTCGTTCAGCTTCCAATATCGACGTGGCCAT
CAGATCTTGTCGGGCAGAGTCGAGTAATCTGTTGCAAAACCGCCAAGAAATGCGATACGTCAAGGAAAGCAATAA
TGACGGCTACTGTGATATATCTGGTCATGCTCAGAATATGATATTAGTTGGTGGGTAACAGCTGTCCGTCGTCCC
AGGTGCTGCGCATATACTCAATCAAATTCAGGCTCAGTGGAGCAAGTTAAGATTTTTGTTGGACAGGGTACGTAA
AGAAACGAGATACCCCGCGCTCAAAATCTGAAAAATATCGAAGATGTTTCCGGCGATGAAGGAAAAGGCATAATC
ACCAAGAAGTCGGGCGTAATTTCCAGGTTTATTCGCATCATGGCCTCGCTTGCACACGTCTATTATTTAAACATC
ACGAATCTTCATATATTCTACGACACGGAAGGCGTGCTCATTGCCTTTAATAGGAATGGAAGCATCTTTTTGAAT
CTACGGTACTACGAAGCTTGGCGTGAGTACATCTGTTATTAACTCGTACCATTCCAAATTAAATCTTGATGTTGC
AGATGACATAGCGGTTCAACAAGGGCATGCTGAAAATGCGCTTATTTCTTGGTATCGTATCTATTATCTTTCACT
CACACTTGAATTCTTATAGACCCTAGGTATTTCACAATCGCACATGAGATTGCGCACAACCTGGTGCAACCCCAC
AACTCAGAACATGAATTCTACTTTTCTGCCATATGCGAAAAGCATCTGGTTTCGCTCTCCAAGCTGATCATAGAA
AATGGCGGGAACATTAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail