Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|044380
Gene name
Locationscaffold_02:1318240..1320863
Strand-
Gene length (bp)2623
Transcript length (bp)2313
Coding sequence length (bp)2313
Protein length (aa) 771

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 5.7E-12 321 375
PF13639 zf-RING_2 Ring finger domain 7.3E-10 321 375
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.7E-07 322 374
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 2.5E-06 316 378
PF13445 zf-RING_UBOX RING-type zinc-finger 2.2E-05 322 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 23 415 7.0E-82
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 30 412 4.0E-80
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 23 422 4.0E-79
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 23 386 3.0E-78
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 23 384 1.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 23 415 7.0E-82
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 30 412 4.0E-80
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 23 422 4.0E-79
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 23 386 3.0E-78
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 23 384 1.0E-77
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 23 384 2.0E-77
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 23 412 4.0E-76
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 31 387 2.0E-73
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 31 387 3.0E-73
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 31 380 3.0E-67
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 31 378 7.0E-66
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 26 379 6.0E-60
sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 52 378 8.0E-31
sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 52 378 2.0E-30
sp|Q75CC8|HRD1_ASHGO ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HRD1 PE=3 SV=2 53 383 6.0E-22
sp|Q08109|HRD1_YEAST ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD1 PE=1 SV=1 236 380 3.0E-14
sp|Q8VYC8|RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana GN=RIN2 PE=1 SV=1 56 376 9.0E-14
sp|Q8W4Q5|RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana GN=RIN3 PE=1 SV=2 56 376 5.0E-11
sp|A8WWR3|HRDL1_CAEBR E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis briggsae GN=hrdl-1 PE=3 SV=1 243 382 1.0E-08
sp|P30631|YOUD_CAEEL Uncharacterized RING finger protein ZK637.14 OS=Caenorhabditis elegans GN=ZK637.14 PE=3 SV=2 298 378 2.0E-08
sp|P90859|HRDL1_CAEEL E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis elegans GN=hrdl-1 PE=1 SV=2 243 386 5.0E-08
sp|Q5SWK7|RN145_MOUSE RING finger protein 145 OS=Mus musculus GN=Rnf145 PE=2 SV=1 207 408 3.0E-07
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 298 412 4.0E-07
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 309 390 7.0E-07
sp|Q7ZWF4|RN145_DANRE RING finger protein 145 OS=Danio rerio GN=rnf145 PE=2 SV=1 283 396 1.0E-06
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 319 378 1.0E-06
sp|Q96MT1|RN145_HUMAN RING finger protein 145 OS=Homo sapiens GN=RNF145 PE=2 SV=2 283 405 1.0E-06
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 298 387 2.0E-06
sp|Q7TPV2|DZIP3_MOUSE E3 ubiquitin-protein ligase DZIP3 OS=Mus musculus GN=Dzip3 PE=1 SV=2 322 381 2.0E-06
sp|Q86Y13|DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens GN=DZIP3 PE=1 SV=2 322 381 7.0E-06
sp|Q5BIY5|RN145_XENLA RING finger protein 145 OS=Xenopus laevis GN=rnf145 PE=2 SV=1 283 419 7.0E-06
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 304 387 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0046872 metal ion binding Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0043169 cation binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0044238 primary metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1990234 transferase complex No
GO:0009056 catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0032991 protein-containing complex No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0030163 protein catabolic process No
GO:0008150 biological_process No
GO:0046914 transition metal ion binding No
GO:1902494 catalytic complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0006508 proteolysis No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0140513 nuclear protein-containing complex No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0140535 intracellular protein-containing complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 24 43 19
2 64 86 22
3 121 138 17
4 158 180 22
5 195 217 22
6 258 280 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|044380
MPPLQQLLRHGSNRVLRSALSHRVQLYFLVSLVALSAVVFNALRNYSNFYSVAISLSKSSRSVLVLANFAVLLAL
LGAHIVQRIFFGALRANEVERLYDRLWFFITESLLAFTIFRDEFDIGFVLMFGFLLFVKSFHWLSSDRVEWMDQQ
QYPGPPVLFHIRMISLFSILWLVDFMMFVIAMDHTIAYGVGGMVLFASEYGILMASLMNTVFKYLLFAYDLRRAG
RRGGENAPPWENKSMWVFYIELTTDFLKLTTYLIFFIIIITFYGLPLNIVRDVYITARSFITRLRALHRYQTATR
NMDQRYPNATETELAATSDRTCIICREDMVPAVQGQPPVSDGPNVTPKKLPCGHIFHFYCLRSWLERQQSCPTCR
QTVLEPNTPRRPANGPAVAPQQQGNAPAGQPGNDAPAVNNPIGNPLGLLGRILGPPGLGADRNPLVPPRVAQNMG
ANGGNNPIVIEYTIQYRTPQNNAQNTPVNLRPVQPLEGLPGPNGWQQWPGRRDNDNEARNPPGPTSEATSTVPNA
VPTDARDTAGESHGSENPRAAAALAALRRLNGNNSSEENEPSPRDTSGLTTSSDLQTDTLRSYSASSTVPQFIPL
FDLSQSRSAQESLPCANGTMPPQTFSANTEPSPASHPEDFMNQLPRHITDTQLSLMDRLTRETIDERLRILERVS
GTAYGCVEDLLRLRSALPVTDTLYARRTSDRGPDHVNSGHRAESANENLDRSPEVLDKGKGVDRSLGPEPVEGSS
EMADAGNSQQENGIETPSGM*
Coding >Agabi119p4|044380
ATGCCTCCTCTCCAACAACTCCTCCGCCATGGCTCAAATCGTGTCCTCCGCTCCGCTCTCTCCCATCGCGTCCAG
CTCTATTTCCTCGTCTCCCTCGTCGCTCTCTCCGCCGTCGTCTTCAATGCTCTCCGCAACTATAGTAACTTCTAT
TCAGTCGCCATATCGCTGTCCAAAAGTAGTCGCAGTGTTCTCGTCCTCGCCAATTTTGCTGTGCTTCTGGCCCTG
TTGGGTGCACACATTGTCCAGCGTATCTTCTTTGGTGCTCTTCGTGCGAACGAGGTCGAGCGGCTTTATGACCGA
CTCTGGTTCTTCATTACGGAGTCCCTTTTGGCGTTCACCATTTTCCGTGATGAATTTGACATAGGTTTCGTCCTC
ATGTTCGGGTTTTTGCTCTTCGTCAAGTCTTTTCACTGGCTGTCGAGTGATCGCGTTGAATGGATGGACCAACAA
CAGTATCCCGGTCCGCCAGTACTCTTTCACATACGGATGATATCATTGTTTTCGATCCTGTGGCTCGTGGATTTC
ATGATGTTCGTCATCGCAATGGATCACACGATTGCATATGGTGTTGGTGGTATGGTTTTATTTGCCAGCGAATAT
GGAATTCTCATGGCCAGCCTCATGAACACCGTTTTCAAATATCTTCTCTTCGCTTATGATTTGCGGCGCGCAGGG
CGTCGTGGAGGAGAAAACGCACCTCCTTGGGAAAATAAATCGATGTGGGTGTTCTATATCGAACTGACCACAGAT
TTCCTCAAGTTGACGACTTATCTCATCTTTTTCATCATCATCATAACGTTCTACGGTCTTCCTCTCAACATAGTT
CGAGATGTTTACATCACTGCACGCTCTTTTATCACCCGCTTACGTGCACTACACCGCTACCAGACGGCGACCCGT
AACATGGATCAGCGTTATCCGAATGCTACTGAAACTGAGTTAGCCGCCACGTCCGATCGTACTTGTATCATCTGT
CGCGAAGACATGGTGCCAGCTGTTCAAGGTCAACCTCCAGTAAGCGATGGACCAAATGTCACTCCCAAAAAACTT
CCTTGTGGCCACATCTTCCATTTCTATTGCCTTCGTTCTTGGCTGGAAAGGCAGCAAAGCTGTCCAACATGTCGT
CAAACTGTGCTCGAGCCGAACACACCCCGACGACCAGCCAATGGACCCGCAGTCGCACCGCAGCAACAGGGAAAT
GCTCCAGCTGGTCAACCTGGAAATGATGCCCCGGCCGTTAATAATCCAATAGGGAATCCATTAGGACTCCTTGGA
CGCATCCTTGGTCCCCCCGGGCTCGGTGCCGATCGCAACCCTCTGGTTCCCCCTCGCGTTGCGCAGAATATGGGT
GCGAATGGTGGTAACAATCCAATAGTAATTGAATATACCATTCAATATCGAACTCCGCAAAATAATGCACAGAAT
ACGCCAGTCAATCTGCGTCCTGTACAACCTCTGGAGGGACTTCCGGGCCCAAACGGTTGGCAACAATGGCCAGGT
CGTCGCGACAATGACAACGAGGCACGGAACCCACCAGGTCCAACTAGTGAAGCGACGTCTACAGTGCCTAATGCA
GTGCCTACGGATGCGCGGGATACAGCTGGTGAAAGTCATGGTTCCGAGAATCCTAGAGCCGCTGCTGCACTTGCG
GCACTGCGCCGTCTGAACGGGAACAACTCTTCAGAGGAGAATGAACCTTCACCTCGTGATACCAGCGGACTGACT
ACGTCTTCGGATCTTCAGACAGATACACTACGCTCGTATTCCGCTTCCTCAACGGTTCCACAGTTCATTCCCCTA
TTTGATCTCTCTCAGTCGCGATCAGCTCAGGAATCTTTACCGTGTGCAAATGGAACAATGCCCCCCCAGACATTC
TCGGCAAATACTGAGCCCTCACCTGCGTCACACCCAGAAGATTTCATGAACCAGCTTCCTAGGCACATCACTGAC
ACTCAGCTGTCGCTCATGGACAGGTTGACCCGAGAAACTATCGACGAGCGCCTCCGCATTCTAGAACGCGTGTCA
GGAACCGCCTATGGCTGTGTGGAAGACTTGCTCAGACTTCGGAGCGCCCTTCCCGTGACAGACACCTTGTATGCC
AGACGTACCTCAGATAGAGGACCCGACCATGTGAATAGCGGACATAGGGCCGAAAGTGCCAACGAAAACCTTGAC
CGTTCTCCTGAAGTTTTGGACAAGGGTAAAGGAGTTGATCGGAGTCTCGGTCCTGAGCCGGTCGAAGGCTCGTCC
GAAATGGCAGATGCAGGCAATTCTCAACAAGAGAATGGCATTGAAACACCTAGTGGGATGTGA
Transcript >Agabi119p4|044380
ATGCCTCCTCTCCAACAACTCCTCCGCCATGGCTCAAATCGTGTCCTCCGCTCCGCTCTCTCCCATCGCGTCCAG
CTCTATTTCCTCGTCTCCCTCGTCGCTCTCTCCGCCGTCGTCTTCAATGCTCTCCGCAACTATAGTAACTTCTAT
TCAGTCGCCATATCGCTGTCCAAAAGTAGTCGCAGTGTTCTCGTCCTCGCCAATTTTGCTGTGCTTCTGGCCCTG
TTGGGTGCACACATTGTCCAGCGTATCTTCTTTGGTGCTCTTCGTGCGAACGAGGTCGAGCGGCTTTATGACCGA
CTCTGGTTCTTCATTACGGAGTCCCTTTTGGCGTTCACCATTTTCCGTGATGAATTTGACATAGGTTTCGTCCTC
ATGTTCGGGTTTTTGCTCTTCGTCAAGTCTTTTCACTGGCTGTCGAGTGATCGCGTTGAATGGATGGACCAACAA
CAGTATCCCGGTCCGCCAGTACTCTTTCACATACGGATGATATCATTGTTTTCGATCCTGTGGCTCGTGGATTTC
ATGATGTTCGTCATCGCAATGGATCACACGATTGCATATGGTGTTGGTGGTATGGTTTTATTTGCCAGCGAATAT
GGAATTCTCATGGCCAGCCTCATGAACACCGTTTTCAAATATCTTCTCTTCGCTTATGATTTGCGGCGCGCAGGG
CGTCGTGGAGGAGAAAACGCACCTCCTTGGGAAAATAAATCGATGTGGGTGTTCTATATCGAACTGACCACAGAT
TTCCTCAAGTTGACGACTTATCTCATCTTTTTCATCATCATCATAACGTTCTACGGTCTTCCTCTCAACATAGTT
CGAGATGTTTACATCACTGCACGCTCTTTTATCACCCGCTTACGTGCACTACACCGCTACCAGACGGCGACCCGT
AACATGGATCAGCGTTATCCGAATGCTACTGAAACTGAGTTAGCCGCCACGTCCGATCGTACTTGTATCATCTGT
CGCGAAGACATGGTGCCAGCTGTTCAAGGTCAACCTCCAGTAAGCGATGGACCAAATGTCACTCCCAAAAAACTT
CCTTGTGGCCACATCTTCCATTTCTATTGCCTTCGTTCTTGGCTGGAAAGGCAGCAAAGCTGTCCAACATGTCGT
CAAACTGTGCTCGAGCCGAACACACCCCGACGACCAGCCAATGGACCCGCAGTCGCACCGCAGCAACAGGGAAAT
GCTCCAGCTGGTCAACCTGGAAATGATGCCCCGGCCGTTAATAATCCAATAGGGAATCCATTAGGACTCCTTGGA
CGCATCCTTGGTCCCCCCGGGCTCGGTGCCGATCGCAACCCTCTGGTTCCCCCTCGCGTTGCGCAGAATATGGGT
GCGAATGGTGGTAACAATCCAATAGTAATTGAATATACCATTCAATATCGAACTCCGCAAAATAATGCACAGAAT
ACGCCAGTCAATCTGCGTCCTGTACAACCTCTGGAGGGACTTCCGGGCCCAAACGGTTGGCAACAATGGCCAGGT
CGTCGCGACAATGACAACGAGGCACGGAACCCACCAGGTCCAACTAGTGAAGCGACGTCTACAGTGCCTAATGCA
GTGCCTACGGATGCGCGGGATACAGCTGGTGAAAGTCATGGTTCCGAGAATCCTAGAGCCGCTGCTGCACTTGCG
GCACTGCGCCGTCTGAACGGGAACAACTCTTCAGAGGAGAATGAACCTTCACCTCGTGATACCAGCGGACTGACT
ACGTCTTCGGATCTTCAGACAGATACACTACGCTCGTATTCCGCTTCCTCAACGGTTCCACAGTTCATTCCCCTA
TTTGATCTCTCTCAGTCGCGATCAGCTCAGGAATCTTTACCGTGTGCAAATGGAACAATGCCCCCCCAGACATTC
TCGGCAAATACTGAGCCCTCACCTGCGTCACACCCAGAAGATTTCATGAACCAGCTTCCTAGGCACATCACTGAC
ACTCAGCTGTCGCTCATGGACAGGTTGACCCGAGAAACTATCGACGAGCGCCTCCGCATTCTAGAACGCGTGTCA
GGAACCGCCTATGGCTGTGTGGAAGACTTGCTCAGACTTCGGAGCGCCCTTCCCGTGACAGACACCTTGTATGCC
AGACGTACCTCAGATAGAGGACCCGACCATGTGAATAGCGGACATAGGGCCGAAAGTGCCAACGAAAACCTTGAC
CGTTCTCCTGAAGTTTTGGACAAGGGTAAAGGAGTTGATCGGAGTCTCGGTCCTGAGCCGGTCGAAGGCTCGTCC
GAAATGGCAGATGCAGGCAATTCTCAACAAGAGAATGGCATTGAAACACCTAGTGGGATGTGA
Gene >Agabi119p4|044380
ATGCCTCCTCTCCAACAACTCCTCCGCCATGGCTCAAATCGTGTCCTCCGCTCCGCTCTCTCCCATCGCGTCCAG
CTCTATTTCCTCGTCTCCCTCGTCGCTCTCTCCGCCGTCGTCTTCAATGCTCTCCGCAACTATAGTAACTTCTAT
TCAGTCGCCATATCGCTGTCCAAAAGTAGTCGCAGTGTTCTCGTGCGTTTCAGAACTGCACCTCGAGGTGCTGTT
TAACCCTTTTTCCAGGTCCTCGCCAATTTTGCTGTGCTTCTGGCCCTGTTGGGTGCACACATTGTCCAGCGTATC
TTCTTTGGTGCTCTTCGTGCGAACGAGGTCGAGGTGCGTTTCCGACCACTCGTACCAGTCACTCATAGTAATCGC
TTGTCTCTTTCAGCGGCTTTATGACCGACTCTGGTTCTTCATTACGGAGTCCCTTTTGGCGTTCACCATTTTCCG
TGATGAATTTGACATAGGTTTCGTCCTCATGTTCGGGTTTTTGCTCTTCGTCAAGTCTTTTCACTGGCTGTCGAG
TGATCGCGTTGAATGGGTAATTACTAGCTTATTCCAGACTACCCCTTTTTGACTGTGCATCCTAGATGGACCAAC
AACAGTATCCCGGTCCGCCAGTACTCTTTCACATACGGATGATATCATTGTTTTCGATCCTGTGGCTCGTGGATT
TCATGATGTTCGTCATCGCAATGGATCACACGATTGCATATGGTGTTGGTGGTATGGTTTTATTTGCCAGCGAAG
TTGGTTTGTCTTTGAAGAGTTCATTCAAACATCTGACAATTCCTAATAGTATGGAATTCTCATGGCCAGCCTCAT
GAACACCGTTTTCAAATATCTTCTCTTCGCTTATGATTTGCGGCGCGCAGGGCGTCGTGGAGGAGAAAACGCACC
TCCTTGGGAAAATAAATCGATGTGGGTGTTCTATATCGAACTGACCACAGGTGAGTAGTGCCCGCTCTCCTACAT
AATTCAATGGTTTACAGGCGCTAGATTTCCTCAAGTTGACGACTTATCTCATCTTTTTCATCATCATCATAACGT
TCTACGGTCTTCCTCTCAACATAGTTCGAGATGTTTACATCACTGCACGCTCTTTTATCACCCGCTTACGTGCAC
TACACCGCTACCAGACGGCGACCCGTAACATGGATCAGCGTTATCCGAATGCTACTGAAACTGAGTTAGCCGCCA
CGTCCGATCGTACTTGTATCATCTGTCGCGAAGACATGGTGCCAGCTGTTCAAGGTCAACCTCCAGTAAGCGATG
GACCAAATGTCACTCCCAAAAAACTTCCTTGTGGCCACATCTTCCATTTCTATTGCCTTCGTTCTTGGCTGGAAA
GGCAGCAAAGCTGTCCAACATGGTCTGTACAGACTTTTCATCTCCGTCGTGCCATCAATTCATCACTTTGATAAT
TTCCAGTCGTCAAACTGTGCTCGAGCCGAACACACCCCGACGACCAGCCAATGGACCCGCAGTCGCACCGCAGCA
ACAGGGAAATGCTCCAGCTGGTCAACCTGGAAATGATGCCCCGGCCGTTAATAATCCAATAGGGAATCCATTAGG
ACTCCTTGGACGCATCCTTGGTCCCCCCGGGCTCGGTGCCGATCGCAACCCTCTGGTTCCCCCTCGCGTTGCGCA
GAATATGGGTGCGAATGGTGGTAACAATCCAATAGTAATTGAATATACCATTCAATATCGAACTCCGCAAAATAA
TGCACAGAATACGCCAGTCAATCTGCGTCCTGTACAACCTCTGGAGGGACTTCCGGGCCCAAACGGTTGGCAACA
ATGGCCAGGTCGTCGCGACAATGACAACGAGGCACGGAACCCACCAGGTCCAACTAGTGAAGCGACGTCTACAGT
GCCTAATGCAGTGCCTACGGATGCGCGGGATACAGCTGGTGAAAGTCATGGTTCCGAGAATCCTAGAGCCGCTGC
TGCACTTGCGGCACTGCGCCGTCTGAACGGGAACAACTCTTCAGAGGAGAATGAACCTTCACCTCGTGATACCAG
CGGACTGACTACGTCTTCGGATCTTCAGACAGATACACTACGCTCGTATTCCGCTTCCTCAACGGTTCCACAGTT
CATTCCCCTATTTGATCTCTCTCAGTCGCGATCAGCTCAGGAATCTTTACCGTGTGCAAATGGAACAATGCCCCC
CCAGACATTCTCGGCAAATACTGAGCCCTCACCTGCGTCACACCCAGAAGATTTCATGAACCAGCTTCCTAGGCA
CATCACTGACACTCAGCTGTCGCTCATGGACAGGTTGACCCGAGAAACTATCGACGAGCGCCTCCGCATTCTAGA
ACGCGTGTCAGGAACCGCCTATGGCTGTGTGGAAGACTTGCTCAGACTTCGGAGCGCCCTTCCCGTGACAGACAC
CTTGTATGCCAGACGTACCTCAGATAGAGGACCCGACCATGTGAATAGCGGACATAGGGCCGAAAGTGCCAACGA
AAACCTTGACCGTTCTCCTGAAGTTTTGGACAAGGGTAAAGGAGTTGATCGGAGTCTCGGTCCTGAGCCGGTCGA
AGGCTCGTCCGAAATGGCAGATGCAGGCAATTCTCAACAAGAGAATGGCATTGAAACACCTAGTGGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail