Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|044280
Gene name
Locationscaffold_02:1297481..1298721
Strand+
Gene length (bp)1240
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10369 ALS_ss_C Small subunit of acetolactate synthase 4.4E-15 262 316
PF01842 ACT ACT domain 1.6E-12 94 158
PF13710 ACT_5 ACT domain 2.2E-06 103 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25605|ILV6_YEAST Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2 44 344 1.0E-99
sp|O60086|ILV6_SCHPO Probable acetolactate synthase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.04 PE=1 SV=2 44 318 2.0E-70
sp|Q57625|ILVH_METJA Probable acetolactate synthase small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvH PE=3 SV=1 93 318 3.0E-21
sp|Q55141|ILVH_SYNY3 Acetolactate synthase small subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvH PE=3 SV=2 93 183 4.0E-20
sp|O28555|ILVH_ARCFU Probable acetolactate synthase small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvH PE=3 SV=1 93 182 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25605|ILV6_YEAST Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2 44 344 1.0E-99
sp|O60086|ILV6_SCHPO Probable acetolactate synthase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.04 PE=1 SV=2 44 318 2.0E-70
sp|Q57625|ILVH_METJA Probable acetolactate synthase small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvH PE=3 SV=1 93 318 3.0E-21
sp|Q55141|ILVH_SYNY3 Acetolactate synthase small subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvH PE=3 SV=2 93 183 4.0E-20
sp|O28555|ILVH_ARCFU Probable acetolactate synthase small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvH PE=3 SV=1 93 182 1.0E-19
sp|A0QUX7|ILVH_MYCS2 Acetolactate synthase small subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ilvH PE=1 SV=1 94 182 5.0E-19
sp|P9WKJ3|ILVH_MYCTU Putative acetolactate synthase small subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvH PE=1 SV=1 92 182 5.0E-18
sp|P9WKJ2|ILVH_MYCTO Putative acetolactate synthase small subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvH PE=3 SV=1 92 182 5.0E-18
sp|P65162|ILVH_MYCBO Acetolactate synthase small subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvH PE=3 SV=1 92 182 5.0E-18
sp|Q9MS98|ILVH_GALSU Acetolactate synthase small subunit OS=Galdieria sulphuraria GN=ilvH PE=3 SV=1 93 209 2.0E-17
sp|Q59499|ILVH_MYCAV Acetolactate synthase small subunit OS=Mycobacterium avium GN=ilvH PE=3 SV=1 94 182 2.0E-17
sp|Q9TLY1|ILVH_CYACA Acetolactate synthase small subunit OS=Cyanidium caldarium GN=ilvH PE=3 SV=1 93 183 1.0E-16
sp|Q1XDQ7|ILVH_PYRYE Acetolactate synthase small subunit OS=Pyropia yezoensis GN=ilvH PE=3 SV=1 93 195 1.0E-16
sp|P51230|ILVH_PORPU Acetolactate synthase small subunit OS=Porphyra purpurea GN=ilvH PE=3 SV=1 93 184 2.0E-16
sp|O67703|ILVH_AQUAE Acetolactate synthase small subunit OS=Aquifex aeolicus (strain VF5) GN=ilvH PE=3 SV=1 91 194 3.0E-16
sp|O33113|ILVH_MYCLE Acetolactate synthase small subunit OS=Mycobacterium leprae (strain TN) GN=ilvH PE=3 SV=1 94 182 3.0E-16
sp|O27492|ILVH_METTH Probable acetolactate synthase small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvH PE=3 SV=1 94 182 4.0E-16
sp|O78451|ILVH_GUITH Acetolactate synthase small subunit OS=Guillardia theta GN=ilvH PE=3 SV=1 93 184 2.0E-15
sp|P45260|ILVH_HAEIN Acetolactate synthase small subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvH PE=3 SV=1 93 187 4.0E-15
sp|P00894|ILVH_ECOLI Acetolactate synthase isozyme 3 small subunit OS=Escherichia coli (strain K12) GN=ilvH PE=1 SV=3 93 186 2.0E-13
sp|P21622|ILVH_SALTY Acetolactate synthase isozyme 3 small subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvH PE=3 SV=2 93 186 2.0E-13
sp|P57320|ILVH_BUCAI Acetolactate synthase small subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ilvH PE=3 SV=1 93 184 7.0E-13
sp|O85294|ILVH_BUCAP Acetolactate synthase small subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ilvH PE=3 SV=1 93 182 1.0E-12
sp|Q89AP8|ILVH_BUCBP Acetolactate synthase small subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ilvH PE=3 SV=1 91 189 1.0E-12
sp|Q9SMC2|ILVH_NICPL Acetolactate synthase small subunit 1, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 91 184 2.0E-12
sp|Q93YZ7|ILVH2_ARATH Acetolactate synthase small subunit 2, chloroplastic OS=Arabidopsis thaliana GN=At2g31810 PE=1 SV=1 91 184 1.0E-11
sp|Q9FFF4|ILVH1_ARATH Acetolactate synthase small subunit 1, chloroplastic OS=Arabidopsis thaliana GN=VAT1 PE=1 SV=1 71 183 1.0E-11
sp|Q93YZ7|ILVH2_ARATH Acetolactate synthase small subunit 2, chloroplastic OS=Arabidopsis thaliana GN=At2g31810 PE=1 SV=1 92 183 3.0E-11
sp|Q9FFF4|ILVH1_ARATH Acetolactate synthase small subunit 1, chloroplastic OS=Arabidopsis thaliana GN=VAT1 PE=1 SV=1 91 183 3.0E-11
sp|P37252|ILVH_BACSU Acetolactate synthase small subunit OS=Bacillus subtilis (strain 168) GN=ilvH PE=3 SV=3 93 182 3.0E-11
sp|Q9SMC2|ILVH_NICPL Acetolactate synthase small subunit 1, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 96 183 3.0E-08
sp|P37252|ILVH_BACSU Acetolactate synthase small subunit OS=Bacillus subtilis (strain 168) GN=ilvH PE=3 SV=3 268 316 2.0E-07
sp|Q9TLY1|ILVH_CYACA Acetolactate synthase small subunit OS=Cyanidium caldarium GN=ilvH PE=3 SV=1 261 323 5.0E-07
sp|O28555|ILVH_ARCFU Probable acetolactate synthase small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvH PE=3 SV=1 264 316 9.0E-07
sp|O67703|ILVH_AQUAE Acetolactate synthase small subunit OS=Aquifex aeolicus (strain VF5) GN=ilvH PE=3 SV=1 268 326 3.0E-06
sp|P51230|ILVH_PORPU Acetolactate synthase small subunit OS=Porphyra purpurea GN=ilvH PE=3 SV=1 255 323 6.0E-06
sp|O27492|ILVH_METTH Probable acetolactate synthase small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvH PE=3 SV=1 268 316 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|044280
MASALTGSVRRALQNVSTRSLSTVRTLQNDAIKPPQPPKPIDDSTSALDYKRSHRVRPPPLPAMDLPRKRSAEEA
VTNILYNTPPPSLQPFKKHILNCLVQNEPGVLSRVSGILAGRGFNIDSLVVCRTEIRDLSRMCIVLSGQDGVVEQ
ARRQLEDLVPVWAVLDYTETNVIQRELLLVKVSILGSEYLDEQLEGGPSHDPRRADSSKLEREAALAENFERGAS
QQQQQQQQNTVLHHEIAPTITASEALRLKHQHLHSLSILSKEFGAKILDIAENSVIVELTAKTPRVEAFLSLLKP
FGILESARTGLMAMPRTPIVRSDGDEEVFADQGGVVDASLLPPG*
Coding >Agabi119p4|044280
ATGGCCAGCGCCTTGACTGGTAGTGTCCGTAGAGCATTGCAGAATGTTTCGACACGGTCCCTTTCAACTGTTCGC
ACTTTGCAAAATGACGCTATCAAACCACCTCAGCCCCCAAAACCCATAGATGACTCAACGTCAGCACTCGATTAT
AAACGTTCGCATCGAGTACGCCCGCCTCCTTTACCGGCAATGGACCTTCCCAGGAAGCGTAGTGCCGAAGAAGCC
GTCACCAATATCCTCTACAACACCCCACCACCTAGCCTTCAGCCGTTTAAAAAACACATCCTCAATTGCTTGGTA
CAAAACGAACCAGGAGTTCTCTCTCGGGTGTCTGGTATTCTGGCTGGAAGAGGGTTCAACATCGATTCGCTCGTC
GTTTGCCGGACTGAGATACGCGACCTCAGTCGTATGTGTATTGTTCTGAGCGGTCAGGACGGAGTCGTTGAACAA
GCCAGAAGACAGCTGGAGGACCTTGTGCCTGTTTGGGCAGTCCTCGACTATACGGAGACAAACGTGATTCAACGT
GAACTTCTTCTGGTCAAAGTGTCCATCCTTGGATCGGAATATCTCGACGAACAGCTCGAAGGCGGTCCTTCCCAT
GATCCACGCAGAGCCGATTCTTCCAAACTCGAACGCGAAGCCGCCCTCGCCGAAAACTTTGAGCGCGGTGCTAGT
CAACAACAGCAGCAGCAGCAGCAAAATACTGTCCTTCACCACGAAATTGCACCAACTATTACAGCTTCCGAAGCT
CTCCGCCTCAAGCATCAACATCTTCACTCCTTATCTATCCTGTCCAAAGAATTTGGAGCCAAAATTTTGGATATC
GCTGAGAATAGTGTGATTGTGGAGTTGACGGCCAAAACTCCGAGAGTGGAGGCTTTCCTGAGCTTGTTGAAACCG
TTTGGCATTCTAGAATCTGCCCGCACCGGTCTGATGGCGATGCCGAGAACACCTATCGTCAGGTCAGACGGAGAC
GAAGAGGTGTTTGCTGACCAGGGAGGAGTCGTGGACGCTAGTCTTCTTCCACCCGGCTAA
Transcript >Agabi119p4|044280
ATGGCCAGCGCCTTGACTGGTAGTGTCCGTAGAGCATTGCAGAATGTTTCGACACGGTCCCTTTCAACTGTTCGC
ACTTTGCAAAATGACGCTATCAAACCACCTCAGCCCCCAAAACCCATAGATGACTCAACGTCAGCACTCGATTAT
AAACGTTCGCATCGAGTACGCCCGCCTCCTTTACCGGCAATGGACCTTCCCAGGAAGCGTAGTGCCGAAGAAGCC
GTCACCAATATCCTCTACAACACCCCACCACCTAGCCTTCAGCCGTTTAAAAAACACATCCTCAATTGCTTGGTA
CAAAACGAACCAGGAGTTCTCTCTCGGGTGTCTGGTATTCTGGCTGGAAGAGGGTTCAACATCGATTCGCTCGTC
GTTTGCCGGACTGAGATACGCGACCTCAGTCGTATGTGTATTGTTCTGAGCGGTCAGGACGGAGTCGTTGAACAA
GCCAGAAGACAGCTGGAGGACCTTGTGCCTGTTTGGGCAGTCCTCGACTATACGGAGACAAACGTGATTCAACGT
GAACTTCTTCTGGTCAAAGTGTCCATCCTTGGATCGGAATATCTCGACGAACAGCTCGAAGGCGGTCCTTCCCAT
GATCCACGCAGAGCCGATTCTTCCAAACTCGAACGCGAAGCCGCCCTCGCCGAAAACTTTGAGCGCGGTGCTAGT
CAACAACAGCAGCAGCAGCAGCAAAATACTGTCCTTCACCACGAAATTGCACCAACTATTACAGCTTCCGAAGCT
CTCCGCCTCAAGCATCAACATCTTCACTCCTTATCTATCCTGTCCAAAGAATTTGGAGCCAAAATTTTGGATATC
GCTGAGAATAGTGTGATTGTGGAGTTGACGGCCAAAACTCCGAGAGTGGAGGCTTTCCTGAGCTTGTTGAAACCG
TTTGGCATTCTAGAATCTGCCCGCACCGGTCTGATGGCGATGCCGAGAACACCTATCGTCAGGTCAGACGGAGAC
GAAGAGGTGTTTGCTGACCAGGGAGGAGTCGTGGACGCTAGTCTTCTTCCACCCGGCTAA
Gene >Agabi119p4|044280
ATGGCCAGCGCCTTGACTGGTAGTGTCCGTAGAGCATTGCAGAATGTTTCGACACGGTCCCTTTCAACTGTTCGC
ACTTTGCAAAATGACGCTATCAAACCACCTCAGCCCCCAAAACCCATAGATGACTCAACGTCAGCACTCGATTAT
AAACGTTCGCATCGAGTACGCCCGCCTCCTTTACCGGCAATGGACCTTCCCAGGAAGCGTAGTGCCGAAGAAGCC
GTCACCAATATCCTCTACAACACCCCACCACCTAGCCTTCAGCCGTTTAAAAAGTAAGTTAAGTCTACGTTTGAT
TTTACAACGACATAATAAAAAATTCTCTTCCCATTTTTTTCAGACACATCCTCAATTGCTTGGTACAAAACGAAC
CAGGAGTTCTCTCTCGGGTGTCTGGTATTCTGGCTGGAAGAGGGTTCAACATCGATTCGCTCGTCGTTTGCCGGA
CTGAGATACGCGACCTCAGTCGTATGTGTATTGTTCTGAGCGGTCAGGACGGAGTCGTTGAACAAGCCAGAAGAC
AGCTGGAGGACCTTGTAGGTGTCAAGATTTCATTTTCTTATTGAAGCGATGTTGATCGTTTTTCGTTTTCCCCCC
TATTGTTTCTATTTATAAGGTGCCTGTTTGGGCAGTCCTCGACTATACGGAGACAAACGTGATTCAACGTGAACT
TCTTCTGGTCAAAGTGTCCATCCTTGGATCGGAATATCTCGACGAACAGCTCGAAGGCGGTCCTTCCCATGATCC
ACGCAGAGCCGATTCTTCCAAACTCGAACGCGAAGCCGCCCTCGCCGAAAACTTTGAGCGCGGTGCTAGTCAACA
ACAGCAGCAGCAGCAGCAAAATACTGTCCTTCACCACGAAATTGCACCAACTATTACAGCTTCCGAAGCTCTCCG
CCTCAAGCATCAACATCTTCACTCCTTATCTATCCTGTCCAAAGAATTTGGAGCCAAAATTTTGGATATCGCTGA
GAATAGTGTGATTGTGGAGTTGACGGCCAAAACTCCGAGAGTGGAGGCTTTCCTGAGCTTGTTGAAACCGTTTGG
CATTCTAGAATCTGCCCGCACCGGTAAGTTTGATTCATAAATCACAGACATAAAGAATGTTCAAGGTGATTTTTC
TTTCTTAGGTCTGATGGCGATGCCGAGAACACCTATCGTCAGGTCAGACGGAGACGAAGAGGTGTTTGCTGACCA
GGGAGGAGTCGTGGACGCTAGTCTTCTTCCACCCGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail