Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|044160
Gene name
Locationscaffold_02:1277539..1278707
Strand-
Gene length (bp)1168
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02089 Palm_thioest Palmitoyl protein thioesterase 8.0E-91 25 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 5 298 4.0E-57
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 21 302 7.0E-57
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 21 302 9.0E-57
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 21 302 1.0E-55
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 21 302 6.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 5 298 4.0E-57
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 21 302 7.0E-57
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 21 302 9.0E-57
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 21 302 1.0E-55
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 21 302 6.0E-55
sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 21 302 6.0E-54
sp|Q9W3C7|PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster GN=Ppt1 PE=1 SV=2 17 302 3.0E-46
sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 12 309 3.0E-41
sp|Q54CM0|PPT3_DICDI Palmitoyl-protein thioesterase 3 OS=Dictyostelium discoideum GN=ppt3 PE=3 SV=1 20 297 1.0E-32
sp|O70489|PPT2_RAT Lysosomal thioesterase PPT2 OS=Rattus norvegicus GN=Ppt2 PE=2 SV=1 22 293 3.0E-21
sp|O35448|PPT2_MOUSE Lysosomal thioesterase PPT2 OS=Mus musculus GN=Ppt2 PE=1 SV=1 22 293 5.0E-21
sp|Q9UMR5|PPT2_HUMAN Lysosomal thioesterase PPT2 OS=Homo sapiens GN=PPT2 PE=1 SV=4 22 293 3.0E-20
sp|Q9VKH6|PPT2_DROME Lysosomal thioesterase PPT2 homolog OS=Drosophila melanogaster GN=Ppt2 PE=2 SV=1 24 287 7.0E-20
sp|Q6GNY7|PPT2B_XENLA Lysosomal thioesterase PPT2-B OS=Xenopus laevis GN=ppt2-b PE=2 SV=1 22 293 8.0E-20
sp|Q1JQA0|PPT2_BOVIN Lysosomal thioesterase PPT2 OS=Bos taurus GN=PPT2 PE=2 SV=1 24 293 2.0E-19
sp|Q6PCJ9|PPT2A_XENLA Lysosomal thioesterase PPT2-A OS=Xenopus laevis GN=ppt2-a PE=2 SV=1 24 287 4.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|044160
MSLWFLLLGFAVHLALASTIPSPRPLVLWHGLGDSHSSPGMLEFMKLIKEIHPGIFIHSIFISEDLNEDKKAGFY
GNVLEQLEFVADQLAAIPELEAGFDAVGLSQGGQFLRAYVECYNNPPVNNLITFGSQHMGISDIPICKPFDFLCQ
IARKAAKRAVYSTWAQENLIQAQYYRDPNNYASYLHANHFLPYVNNEIEEARNQTYARNFASLSNLVLVMFTEDK
LVVPKESSWFGYEELRDSVVSDASDQQRFLAMDKKIIPMREQPLYIEDWIGLRELDERGAVVFSECVGEHMEMGD
CWEELIVEYTGGSL*
Coding >Agabi119p4|044160
ATGTCACTCTGGTTCCTCCTCCTCGGTTTCGCTGTTCACCTTGCATTGGCGTCTACCATCCCGTCTCCACGGCCA
CTTGTTCTCTGGCATGGTTTGGGGGATTCGCATTCCTCACCCGGAATGCTTGAATTTATGAAGCTCATCAAGGAG
ATACACCCCGGAATCTTCATCCATTCCATATTTATTTCGGAAGACCTGAATGAAGACAAGAAAGCTGGTTTCTAC
GGAAACGTTCTTGAGCAGCTGGAATTTGTGGCAGATCAGCTCGCCGCCATACCAGAACTGGAAGCTGGATTCGAC
GCGGTGGGCCTCTCGCAAGGTGGTCAATTCTTGCGAGCATATGTCGAATGTTACAATAATCCACCCGTCAATAAC
CTCATCACGTTTGGCTCTCAACACATGGGTATCTCTGATATACCCATATGCAAACCGTTCGATTTTCTATGTCAG
ATTGCTCGAAAGGCAGCCAAGAGAGCGGTTTATAGCACCTGGGCTCAAGAAAATCTGATTCAGGCCCAGTATTAT
CGTGATCCAAATAATTATGCATCGTATCTCCACGCGAACCACTTCCTTCCATACGTCAACAATGAAATCGAGGAA
GCGCGCAATCAGACTTATGCACGCAACTTTGCTTCCCTGAGTAATCTCGTGCTGGTCATGTTTACAGAAGACAAG
TTGGTGGTGCCAAAAGAGAGCTCCTGGTTCGGATATGAAGAATTAAGAGACAGCGTTGTGTCCGACGCGTCGGAT
CAGCAGCGCTTCTTAGCAATGGACAAGAAGATCATTCCGATGAGGGAACAACCGCTGTATATTGAAGATTGGATA
GGATTGCGGGAGCTGGATGAGCGCGGGGCGGTTGTTTTTTCCGAGTGCGTTGGCGAGCACATGGAGATGGGAGAC
TGCTGGGAAGAGCTGATTGTCGAGTACACGGGAGGGAGTCTGTAG
Transcript >Agabi119p4|044160
ATGTCACTCTGGTTCCTCCTCCTCGGTTTCGCTGTTCACCTTGCATTGGCGTCTACCATCCCGTCTCCACGGCCA
CTTGTTCTCTGGCATGGTTTGGGGGATTCGCATTCCTCACCCGGAATGCTTGAATTTATGAAGCTCATCAAGGAG
ATACACCCCGGAATCTTCATCCATTCCATATTTATTTCGGAAGACCTGAATGAAGACAAGAAAGCTGGTTTCTAC
GGAAACGTTCTTGAGCAGCTGGAATTTGTGGCAGATCAGCTCGCCGCCATACCAGAACTGGAAGCTGGATTCGAC
GCGGTGGGCCTCTCGCAAGGTGGTCAATTCTTGCGAGCATATGTCGAATGTTACAATAATCCACCCGTCAATAAC
CTCATCACGTTTGGCTCTCAACACATGGGTATCTCTGATATACCCATATGCAAACCGTTCGATTTTCTATGTCAG
ATTGCTCGAAAGGCAGCCAAGAGAGCGGTTTATAGCACCTGGGCTCAAGAAAATCTGATTCAGGCCCAGTATTAT
CGTGATCCAAATAATTATGCATCGTATCTCCACGCGAACCACTTCCTTCCATACGTCAACAATGAAATCGAGGAA
GCGCGCAATCAGACTTATGCACGCAACTTTGCTTCCCTGAGTAATCTCGTGCTGGTCATGTTTACAGAAGACAAG
TTGGTGGTGCCAAAAGAGAGCTCCTGGTTCGGATATGAAGAATTAAGAGACAGCGTTGTGTCCGACGCGTCGGAT
CAGCAGCGCTTCTTAGCAATGGACAAGAAGATCATTCCGATGAGGGAACAACCGCTGTATATTGAAGATTGGATA
GGATTGCGGGAGCTGGATGAGCGCGGGGCGGTTGTTTTTTCCGAGTGCGTTGGCGAGCACATGGAGATGGGAGAC
TGCTGGGAAGAGCTGATTGTCGAGTACACGGGAGGGAGTCTGTAG
Gene >Agabi119p4|044160
ATGTCACTCTGGTTCCTCCTCCTCGGTTTCGCTGTTCACCTTGCATTGGCGTCTACCATCCCGTCTCCACGGCCA
CTTGTTCTCTGGCATGGTTTGGGTAGGAATGAGTCCTTAGGAATACAGAGTAGCATTTGCCCTTAGCTAATTTCC
TCGCGCAGGGGATTCGCATTCCTCACCCGGAATGCTTGAATTTATGAAGCTCATCAAGGAGATACACCCCGGAAT
CTTCATCCATTCCATATTTATTTCGGAAGACCTGAATGAAGACAAGAAAGCTGGTTTCGTATGACAGCCGCGTCT
TTCAAAGTATTCTACTAATTATCGAGAAATGGGTGCATGTAGTACGGAAACGTTCTTGAGCAGCTGGAATTTGTG
GCAGATCAGCTCGCCGCCATACCAGAACTGGAAGCTGGATTCGACGCGGTGGGCCTCTCGCAAGGTTTGTCCAGC
TACTTTATTTGTACTGTTAAGCTAGTATTGAAACAAAGAAGGTGGTCAATTCTTGCGAGCATATGTCGAATGTTA
CAATAATCCACCCGTCAATAACCTCATCACGTTTGGCTCTCAACACATGGGTATCTCTGATATACCCATATGCAA
ACCGTTCGATTTTCTATGTCAGATTGCTCGAAAGGCAGCCAAGAGAGCGGTTTATAGCACCTGGGCTCAAGAAAA
TCTGATTCAGGTGAGCGTTGGCGTTGGTGACCTGAAGATGATTAATTCTTATGTCCTATAGGCCCAGTATTATCG
TGATCCAAATAATTATGCATCGTATCTCCACGCGAACCACTTCCTTCCATACGTCAACAATGAAATCGAGGAAGC
GCGCAATCAGACTTATGCACGCAACTTTGCTTCCCTGAGTAATCTCGTGCTGGTCATGTTTACAGAAGACAAGTT
GGTGGTGCCAAAAGAGAGCTCCTGGTTCGGATATGAAGAATTAAGAGACAGCGTTGTGTCCGACGCGTCGGATCA
GCAGCGCTTCTTAGCAATGGACAAGAAGATCATTCCGATGAGGGAACAACCGCTGTATATTGAAGATTGGATAGG
ATTGCGGGAGCTGGATGAGCGCGGGGCGGTTGTTTTTTCCGAGTGCGTTGGCGAGCACATGGAGATGGGAGACTG
CTGGGAAGAGCTGATTGTCGAGTACACGGGAGGGAGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail