Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|043950
Gene name
Locationscaffold_02:1229937..1231758
Strand-
Gene length (bp)1821
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 5.3E-27 59 274
PF11895 Peroxidase_ext Fungal peroxidase extension region 7.3E-27 278 353

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 16 354 3.0E-143
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 16 354 6.0E-142
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 1 332 2.0E-129
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 1 354 1.0E-115
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 1 346 3.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 16 354 3.0E-143
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 16 354 6.0E-142
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 1 332 2.0E-129
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 1 354 1.0E-115
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 1 346 3.0E-115
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 29 346 9.0E-115
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 1 352 2.0E-110
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 20 332 2.0E-109
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 1 353 4.0E-109
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 1 352 2.0E-108
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 1 352 6.0E-107
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 20 352 1.0E-105
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 1 343 1.0E-104
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 25 352 2.0E-104
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 25 352 1.0E-103
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 25 352 2.0E-103
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 1 352 3.0E-102
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 1 352 2.0E-101
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 29 352 7.0E-88
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 29 352 1.0E-87
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 29 352 4.0E-87
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 46 334 4.0E-69
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 67 294 2.0E-17
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 67 294 2.0E-17
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 67 294 5.0E-17
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 67 294 1.0E-16
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 67 294 2.0E-16
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 67 294 3.0E-15
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 67 294 1.0E-14
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 67 294 1.0E-14
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 34 294 1.0E-14
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 67 294 2.0E-13
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 66 294 6.0E-13
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 67 310 8.0E-13
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 67 306 3.0E-12
sp|Q59X94|CCPR2_CANAL Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP2 PE=3 SV=1 67 300 4.0E-12
sp|Q6BIB1|CCPR2_DEBHA Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G12166g PE=3 SV=3 67 297 7.0E-12
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 46 294 2.0E-11
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 67 294 3.0E-11
sp|Q6URB0|CCPR_CRYNH Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CCP1 PE=3 SV=1 67 300 3.0E-11
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 48 300 5.0E-11
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 67 294 5.0E-11
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 67 310 6.0E-11
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 67 294 7.0E-11
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 67 300 1.0E-10
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 67 300 1.0E-10
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 67 308 2.0E-10
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 67 294 2.0E-10
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 67 296 5.0E-10
sp|Q4ING3|CCPR_GIBZE Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CCP1 PE=3 SV=1 32 294 6.0E-10
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 67 294 6.0E-10
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 67 294 7.0E-10
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 67 307 9.0E-10
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 67 295 2.0E-09
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 67 294 2.0E-09
sp|Q4PD66|CCPR2_USTMA Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP2 PE=3 SV=1 67 294 4.0E-09
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 49 294 5.0E-09
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 67 321 3.0E-08
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 67 296 5.0E-08
sp|P0CP56|CCPR2_CRYNJ Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNE03890 PE=3 SV=1 67 297 2.0E-07
sp|P0CP57|CCPR2_CRYNB Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBE3880 PE=3 SV=1 67 297 2.0E-07
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 47 202 9.0E-07
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 108 290 2.0E-06
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 67 296 2.0E-06
sp|Q43731|PER50_ARATH Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=1 SV=1 66 294 3.0E-06
sp|Q9SI16|PER15_ARATH Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=2 SV=1 67 290 5.0E-06
sp|P19135|PER2_CUCSA Peroxidase 2 (Fragment) OS=Cucumis sativus PE=2 SV=1 122 290 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0050896 response to stimulus No
GO:0046906 tetrapyrrole binding No
GO:0008150 biological_process No
GO:0006950 response to stress No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|043950
MAFKILLSLILALNAVQFIAAVPTRRAQCADGTTVSNEACCVLLPIIADIQPNLFENECGEEVHETLRASFHDAI
GFSRAAGGGGADGSLVTFGDVETTFAANAGIDEIVETLRPFINSHNISAGDFIQFATVVGLTNCPGAPRIPFFLG
RPDATAASPDGLVPEPFDSVTKILERFDDAGFNPTEVVALLASHTVAASDTIEPGLEGVPFDSTPGEFDRQFFIE
TMLKGTSFPGTGGNQGEALSPLPGELRLESDGLLARDERTACDWQLFATDQQKMASAFSDAMVKLSLVGQDKSQL
IDCSDVIPRTIPLTNEPYFPADLTKDDLEKTCPDEFPDYPSNPSVTSVAPVPTS*
Coding >Agabi119p4|043950
ATGGCTTTCAAAATTCTTCTCAGCCTTATTTTGGCTTTGAACGCCGTTCAATTTATTGCTGCTGTTCCTACCAGG
AGGGCCCAATGTGCCGATGGCACCACTGTTTCTAATGAGGCCTGTTGCGTTCTGCTCCCCATTATAGCAGATATC
CAGCCGAACTTGTTCGAAAACGAGTGCGGTGAAGAGGTCCATGAAACCTTGCGGGCATCATTTCATGATGCTATC
GGATTCTCCAGAGCAGCTGGTGGTGGTGGTGCTGATGGTTCTCTCGTCACTTTCGGCGATGTGGAGACCACATTT
GCCGCTAACGCAGGAATCGACGAGATTGTAGAGACATTACGACCTTTTATAAACAGCCACAACATCAGTGCCGGC
GATTTCATCCAGTTTGCAACCGTTGTTGGATTGACCAACTGCCCCGGCGCACCTCGCATACCCTTTTTCTTAGGC
CGCCCAGACGCTACCGCCGCTTCCCCCGATGGTCTTGTCCCTGAGCCCTTCGATTCCGTCACGAAAATTCTTGAA
CGCTTCGATGATGCTGGTTTTAACCCCACTGAAGTTGTTGCATTACTTGCATCTCATACTGTCGCAGCTTCGGAC
ACAATTGAGCCCGGTCTCGAAGGTGTCCCCTTCGACTCGACTCCCGGAGAATTTGACAGGCAGTTCTTTATCGAG
ACTATGCTTAAAGGCACCTCCTTCCCAGGCACTGGGGGGAATCAAGGTGAAGCCTTATCTCCCTTGCCGGGAGAA
CTTCGTCTCGAATCGGATGGACTTTTGGCTCGAGATGAACGAACTGCATGTGACTGGCAACTCTTCGCTACTGAT
CAACAAAAAATGGCATCGGCATTTAGCGACGCCATGGTCAAACTGTCTCTCGTCGGGCAAGATAAGAGCCAATTG
ATTGATTGTTCAGACGTCATTCCGCGAACGATCCCTTTGACAAATGAACCATACTTCCCTGCCGACTTGACCAAA
GATGACCTTGAGAAGACCTGCCCGGATGAATTCCCTGATTACCCTTCCAACCCCAGTGTCACTTCGGTCGCACCA
GTTCCCACCTCGTAA
Transcript >Agabi119p4|043950
ATGGCTTTCAAAATTCTTCTCAGCCTTATTTTGGCTTTGAACGCCGTTCAATTTATTGCTGCTGTTCCTACCAGG
AGGGCCCAATGTGCCGATGGCACCACTGTTTCTAATGAGGCCTGTTGCGTTCTGCTCCCCATTATAGCAGATATC
CAGCCGAACTTGTTCGAAAACGAGTGCGGTGAAGAGGTCCATGAAACCTTGCGGGCATCATTTCATGATGCTATC
GGATTCTCCAGAGCAGCTGGTGGTGGTGGTGCTGATGGTTCTCTCGTCACTTTCGGCGATGTGGAGACCACATTT
GCCGCTAACGCAGGAATCGACGAGATTGTAGAGACATTACGACCTTTTATAAACAGCCACAACATCAGTGCCGGC
GATTTCATCCAGTTTGCAACCGTTGTTGGATTGACCAACTGCCCCGGCGCACCTCGCATACCCTTTTTCTTAGGC
CGCCCAGACGCTACCGCCGCTTCCCCCGATGGTCTTGTCCCTGAGCCCTTCGATTCCGTCACGAAAATTCTTGAA
CGCTTCGATGATGCTGGTTTTAACCCCACTGAAGTTGTTGCATTACTTGCATCTCATACTGTCGCAGCTTCGGAC
ACAATTGAGCCCGGTCTCGAAGGTGTCCCCTTCGACTCGACTCCCGGAGAATTTGACAGGCAGTTCTTTATCGAG
ACTATGCTTAAAGGCACCTCCTTCCCAGGCACTGGGGGGAATCAAGGTGAAGCCTTATCTCCCTTGCCGGGAGAA
CTTCGTCTCGAATCGGATGGACTTTTGGCTCGAGATGAACGAACTGCATGTGACTGGCAACTCTTCGCTACTGAT
CAACAAAAAATGGCATCGGCATTTAGCGACGCCATGGTCAAACTGTCTCTCGTCGGGCAAGATAAGAGCCAATTG
ATTGATTGTTCAGACGTCATTCCGCGAACGATCCCTTTGACAAATGAACCATACTTCCCTGCCGACTTGACCAAA
GATGACCTTGAGAAGACCTGCCCGGATGAATTCCCTGATTACCCTTCCAACCCCAGTGTCACTTCGGTCGCACCA
GTTCCCACCTCGTAA
Gene >Agabi119p4|043950
ATGGCTTTCAAAATTCTTCTCAGCCTTATTTTGGCTTTGAACGCCGTTCAATTTATTGCTGGTACGCACTTTACT
CATATCCTCATATTATTTGCCGACAAGTCAACGATGTAGCTGTTCCTACCAGGAGGGCCCAATGTGCCGATGGCA
CCACTGTTTCTAATGAGGCCTGTTGCGTTCTGCTCCCCATTATAGCAGATATCCAGCCGAACTTGTTCGAAAACG
AGTGCGGTGAAGAGGTAATGATTTAATTTTTTGATATAGTTACGATATTCAACAGCATATTTATACTTTAGGTCC
ATGAAACCTTGCGGGCATCATTTCATGATGCTATCGGATTCTCCAGAGCAGCTGGGTAGGTTCTGACTGTCTGTG
GCGGCAGCTAGTATCGCTAAAATGATTTCCAGTGGTGGTGGTGCTGATGGTTCTCTCGTCACTTTCGGCGATGTG
GAGACCACATTTGCCGCTAACGCAGGAATCGACGAGATTGTAGAGACATTACGACCTTTTATAAACAGCCACAAC
ATCAGTGCCGGCGATTTGTGAGCCTGGACTGATAATCTGCGTTGCATCCTGTTAACGCCCTTCCTAGCATCCAGT
TTGCAACCGTTGTTGGATTGACCAACTGCCCCGGCGCACCTCGCATACCCTTTTTCTTAGGCCGCCCAGACGCTA
CCGCCGCTTCCCCCGATGGTCTTGTCCCTGAGCCCTTCGGTCAGTCTCTCATCAGCCTTTCCGGTATAATCTACA
ACCCAAGTTGATAATCAACAGATTCCGTCACGAAAATTCTTGAACGCTTCGATGATGCTGGTTTTAACCCCACTG
AAGTTGTTGCATTACTTGCATCGTGAGTCTCTAGAACAAGATCGAGAAATATGTGTCCAATCCCCCCGTAGTCAT
ACTGTCGCAGCTTCGGACACAATTGAGCCCGGTGTAAGTTTATTTCTTCGTCAGTATGCATTCTCGTCTCATGAG
CACCTTATTCCAGCTCGAAGGGTAAGACATTCCCTGTCAATAGGAAACGTCTCAGTATCCAACGCAACCTCTAGT
GTCCCCTTCGACTCGACTCCCGGAGAATTTGACAGGCAGTTCTTTATCGAGACTATGCTTAAAGGCACCTCCTTC
CCAGGGTAAGTAGTTCGTTGACATTCGTTACGCATCCTAATTTTGGCAAAGCACTGGGGGGAATCAAGGTGAAGC
CTTATCTCCCTTGCCGGGAGAACTTCGTCTCGAATCGGATGGACTTGTACGTATACAGTCTTTTGTCGTCTGAAT
TTGTGATTGTTAACGTTATTTATCATTAGTTGGCTCGAGGTCTGTCTTGCTAACAAAAGGCATCTGATAACATTG
AAGGACTAACTTGATCATAGATGAACGAACTGCATGTGACTGGCAACTCTTCGCTAGTAAGAATGTTTGCCAACC
AAGAAGAATAGCTCACCTAAAATTCCACGATAGCTGATCAACAAAAAATGGCATCGGCATTTAGCGACGCCATGG
TCAAACTGTCTCTCGTCGGGCAAGATAAGAGCCAATTGATTGATTGTTCAGACGTCATTCCGCGAACGATCCCTT
TGACAAATGAACCATACTTCCCTGCCGACTTGACCAAAGATGACCTTGAGAAGACCGTGAGTCCAATTGACATTC
ACAATACGATTTCCACCCTGAGCCTGTTTGTTTTTGATACAGTGCCCGGATGAATTCCCTGATTACCCTTCCAAC
CCCAGTGTCACTTCGGTCGCACCAGTGTAAGTTTATGATCAGCTCCAGACGTCTGCTCTTATTCACTCTGCGCAA
ATATCTAGTCCCACCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail