Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|043860
Gene name
Locationscaffold_02:1203863..1207775
Strand-
Gene length (bp)3912
Transcript length (bp)2904
Coding sequence length (bp)2904
Protein length (aa) 968

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.3E-67 409 682
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 2.2E-38 17 168
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.7E-31 191 396
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 2.2E-13 889 958

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 16 957 1.0E-113
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 22 960 1.0E-85
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 12 728 3.0E-74
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 69 692 1.0E-47
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 69 735 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 16 957 1.0E-113
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 22 960 1.0E-85
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 12 728 3.0E-74
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 69 692 1.0E-47
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 69 735 2.0E-44
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 69 754 1.0E-38
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 70 735 2.0E-37
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 69 681 2.0E-36
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 70 781 3.0E-34
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 69 689 4.0E-33
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 5 710 2.0E-31
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 69 735 3.0E-27
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 305 737 2.0E-25
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 307 678 3.0E-25
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 351 711 7.0E-25
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 14 751 2.0E-24
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 46 743 4.0E-21
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 320 758 2.0E-20
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 26 682 4.0E-20
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 57 687 5.0E-14
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 48 687 1.0E-13
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 24 733 6.0E-11
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 20 733 2.0E-07
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 66 684 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 99 121 22
3 147 165 18
4 408 430 22
5 461 483 22
6 502 524 22
7 554 576 22
8 613 635 22
9 662 684 22
10 691 713 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|043860
MAAVDPGKALSSSTTRSFVTALVVNGALLGVEVLAFFLLKQKLWRIYGPRTVLPPPHKRAAALPSGIAKWLPALI
RYPAEDIIHKNGLDAYMFLRYIKLLIWIFLVFTLSTFVVIIPADAVGITSDKEGLERISWTNIIQPRDQSRFSAH
IVVAYVLTFFVVWMIRREMAYFVNLRHQFLISPSHSRLAQARTVLITSVPDELANERDLRSFASFVPGGVDRVWL
YRDTRSLNDVFERRQDTCLKLEAAGSSLLVQAVSAWRKKIKHHKKAINRKRKDEEGLTISNDLAIPPLTRAFLDE
LVPPAKRPHHRTGFLGMIGQKVDTIDWCTKEIAELNGILHKERENIVKGKFLGSAFIRCNLQMGAHVLAQCVSYH
EPSTMYSKWMEAHPKDIVWHNLDDGALEVRGRYLTSWAATVGLIIAWAFPVGFIGTLSNLSGFCVKFHWLNWLCA
APKPVLGLIQGVLPPALLAALFSLLPFILRGLAWYECIPRYSLIAVSVYKRFYFFLLIHGFLIVTLSSGITRAIQ
NIIENPAKTVQELASQLPGASVFFLTYMVTQGLAGAGAALVQLAPLALHFLRKWFLGRTPRQAYGVTFLMPHADL
SVIFPRLSLLATIGFAYSVLSPLINLLAFITYLTYYLAWKFLLSQVIDQPDELETGGLYFPMAINNLFVGLYIEQ
VSLACLFFLKASGSVAAAIAQAVLMLVLLCITALAQLLINHSFNPIIKYLPMSLATQQATRRYEKYKEKEGPSNS
DTDDNDVDLFSRTTVRNVRKRTKKTTKQVKNDRDSVKVDSIRDSSSSCDLLEGLNSPQTSDDKIAEALGLTAGSE
LYPMKSLNSIASKASSMSKISLGPRKSSSKASKKKDKALGKKGKSLFFDRHPALSPATEALTDDSDDSEEDDAHA
FDHPSIYVEQPWIWIPRDHLGLSGLLVKELQDAGVNASDLGAEMQVNGVVEVTRNPPDEEWTGGHDA*
Coding >Agabi119p4|043860
ATGGCCGCCGTTGATCCAGGAAAGGCTCTCAGCAGCAGCACGACCCGTAGTTTTGTCACTGCCTTGGTTGTAAAC
GGGGCTCTCCTTGGGGTGGAAGTTCTGGCATTCTTTCTTCTCAAGCAGAAACTGTGGAGAATTTATGGTCCCAGG
ACAGTCCTACCACCTCCACATAAACGAGCAGCAGCGTTACCATCTGGAATAGCCAAATGGCTCCCGGCACTTATA
AGATACCCAGCGGAAGATATTATACACAAGAATGGACTTGATGCTTATATGTTCCTAAGATATATCAAACTCCTC
ATTTGGATTTTTTTGGTCTTCACCCTCTCTACATTCGTCGTTATTATTCCAGCAGATGCCGTTGGGATCACATCT
GATAAAGAAGGCCTAGAAAGAATATCGTGGACAAATATCATTCAACCACGAGATCAAAGCCGATTCAGTGCACAT
ATTGTCGTTGCCTATGTCTTAACATTTTTCGTAGTGTGGATGATTCGTCGCGAGATGGCCTATTTCGTAAATCTG
CGCCACCAATTTCTCATTAGTCCGTCTCATTCTCGGCTCGCACAAGCTCGTACGGTCTTAATCACTTCTGTACCG
GACGAACTGGCCAACGAACGCGATCTCCGCTCATTCGCAAGTTTCGTACCAGGCGGTGTCGACCGCGTTTGGTTA
TATCGTGACACACGATCTTTGAATGATGTGTTCGAGAGGCGACAAGATACATGTCTGAAGTTAGAAGCAGCGGGA
TCTAGCCTACTTGTCCAGGCAGTTTCAGCTTGGAGGAAGAAGATCAAACATCATAAGAAAGCCATCAACAGGAAA
CGAAAGGATGAGGAAGGACTCACTATTTCGAATGACTTGGCAATACCGCCACTAACTCGCGCATTTTTGGACGAG
CTTGTTCCGCCAGCCAAGCGTCCTCATCATCGCACTGGTTTTTTGGGGATGATAGGACAAAAAGTTGATACCATT
GATTGGTGTACGAAAGAGATCGCGGAATTGAATGGCATTCTGCACAAGGAAAGGGAAAATATTGTCAAGGGTAAA
TTCTTGGGAAGTGCATTCATCCGCTGTAATCTTCAGATGGGTGCGCATGTTCTGGCGCAATGTGTTAGCTACCAT
GAACCTTCAACAATGTATTCAAAATGGATGGAAGCTCATCCAAAAGATATAGTTTGGCATAACCTGGACGATGGA
GCTCTGGAAGTACGGGGGCGATATCTCACTTCGTGGGCGGCGACTGTTGGTCTCATAATTGCATGGGCTTTTCCT
GTCGGTTTCATTGGTACTCTGAGTAATTTAAGTGGCTTTTGTGTCAAATTCCACTGGCTTAATTGGTTATGTGCT
GCTCCGAAACCTGTCCTTGGACTCATTCAAGGTGTTCTTCCTCCTGCCTTGCTCGCTGCCCTGTTTTCCCTGCTA
CCATTCATTCTGCGAGGTCTCGCTTGGTATGAATGTATCCCTCGGTATTCTCTCATTGCCGTCAGCGTCTACAAA
CGGTTTTATTTCTTTTTGTTGATCCACGGTTTCTTAATCGTCACGTTGAGTTCTGGAATTACACGGGCGATTCAG
AACATTATTGAGAACCCAGCAAAAACGGTCCAAGAGCTGGCTAGTCAGCTCCCTGGTGCATCAGTATTTTTCCTC
ACTTACATGGTAACGCAGGGCTTGGCAGGTGCTGGGGCAGCACTTGTCCAATTGGCCCCCTTGGCTCTGCACTTC
CTTCGGAAGTGGTTCCTTGGGCGTACCCCGCGCCAAGCATACGGAGTTACCTTTCTCATGCCACATGCTGACTTG
AGTGTGATCTTCCCTCGTCTGTCATTACTTGCCACAATCGGTTTTGCATATAGTGTTTTGTCGCCCCTCATCAAT
CTCCTCGCTTTTATTACTTATCTCACGTACTATTTAGCGTGGAAATTTTTACTATCCCAGGTCATTGACCAACCG
GATGAATTGGAAACCGGCGGCCTTTATTTTCCTATGGCCATCAACAATCTATTTGTCGGCCTTTACATTGAACAA
GTCTCTCTGGCGTGTTTGTTCTTCCTAAAAGCATCCGGTTCGGTTGCGGCTGCTATTGCGCAAGCAGTTCTTATG
CTTGTTCTGTTGTGTATAACCGCTCTGGCACAACTCTTAATCAACCATAGCTTCAACCCCATTATCAAGTACTTA
CCTATGTCCCTGGCGACTCAGCAGGCGACGCGTAGATATGAGAAATATAAGGAAAAGGAAGGACCATCGAACAGT
GATACCGACGATAATGACGTTGATTTATTCAGCCGGACCACGGTTCGCAATGTGCGCAAGCGGACCAAAAAAACA
ACTAAGCAAGTTAAAAACGACCGTGACTCTGTCAAAGTCGATTCCATAAGGGATTCAAGCTCTTCGTGTGATCTT
TTGGAAGGCCTCAACTCGCCTCAGACAAGTGATGATAAAATAGCTGAGGCGTTAGGATTGACAGCAGGGTCAGAA
CTTTACCCTATGAAGTCTCTGAACTCGATTGCGTCGAAGGCTTCATCTATGTCCAAAATATCCCTGGGCCCCAGA
AAATCAAGTAGCAAGGCCTCGAAAAAAAAGGACAAGGCCTTAGGAAAGAAGGGAAAAAGCTTGTTCTTCGATCGA
CATCCTGCCCTGAGTCCTGCCACGGAAGCGCTTACTGATGATTCGGATGACTCGGAAGAAGACGATGCACATGCA
TTTGATCACCCCTCGATATACGTTGAGCAACCTTGGATTTGGATACCCAGAGATCATCTTGGATTGAGTGGATTG
TTGGTGAAGGAGTTGCAGGATGCAGGCGTAAATGCGAGTGATCTTGGTGCAGAGATGCAAGTCAATGGCGTTGTG
GAGGTGACAAGAAACCCGCCTGACGAAGAATGGACCGGAGGGCATGATGCTTGA
Transcript >Agabi119p4|043860
ATGGCCGCCGTTGATCCAGGAAAGGCTCTCAGCAGCAGCACGACCCGTAGTTTTGTCACTGCCTTGGTTGTAAAC
GGGGCTCTCCTTGGGGTGGAAGTTCTGGCATTCTTTCTTCTCAAGCAGAAACTGTGGAGAATTTATGGTCCCAGG
ACAGTCCTACCACCTCCACATAAACGAGCAGCAGCGTTACCATCTGGAATAGCCAAATGGCTCCCGGCACTTATA
AGATACCCAGCGGAAGATATTATACACAAGAATGGACTTGATGCTTATATGTTCCTAAGATATATCAAACTCCTC
ATTTGGATTTTTTTGGTCTTCACCCTCTCTACATTCGTCGTTATTATTCCAGCAGATGCCGTTGGGATCACATCT
GATAAAGAAGGCCTAGAAAGAATATCGTGGACAAATATCATTCAACCACGAGATCAAAGCCGATTCAGTGCACAT
ATTGTCGTTGCCTATGTCTTAACATTTTTCGTAGTGTGGATGATTCGTCGCGAGATGGCCTATTTCGTAAATCTG
CGCCACCAATTTCTCATTAGTCCGTCTCATTCTCGGCTCGCACAAGCTCGTACGGTCTTAATCACTTCTGTACCG
GACGAACTGGCCAACGAACGCGATCTCCGCTCATTCGCAAGTTTCGTACCAGGCGGTGTCGACCGCGTTTGGTTA
TATCGTGACACACGATCTTTGAATGATGTGTTCGAGAGGCGACAAGATACATGTCTGAAGTTAGAAGCAGCGGGA
TCTAGCCTACTTGTCCAGGCAGTTTCAGCTTGGAGGAAGAAGATCAAACATCATAAGAAAGCCATCAACAGGAAA
CGAAAGGATGAGGAAGGACTCACTATTTCGAATGACTTGGCAATACCGCCACTAACTCGCGCATTTTTGGACGAG
CTTGTTCCGCCAGCCAAGCGTCCTCATCATCGCACTGGTTTTTTGGGGATGATAGGACAAAAAGTTGATACCATT
GATTGGTGTACGAAAGAGATCGCGGAATTGAATGGCATTCTGCACAAGGAAAGGGAAAATATTGTCAAGGGTAAA
TTCTTGGGAAGTGCATTCATCCGCTGTAATCTTCAGATGGGTGCGCATGTTCTGGCGCAATGTGTTAGCTACCAT
GAACCTTCAACAATGTATTCAAAATGGATGGAAGCTCATCCAAAAGATATAGTTTGGCATAACCTGGACGATGGA
GCTCTGGAAGTACGGGGGCGATATCTCACTTCGTGGGCGGCGACTGTTGGTCTCATAATTGCATGGGCTTTTCCT
GTCGGTTTCATTGGTACTCTGAGTAATTTAAGTGGCTTTTGTGTCAAATTCCACTGGCTTAATTGGTTATGTGCT
GCTCCGAAACCTGTCCTTGGACTCATTCAAGGTGTTCTTCCTCCTGCCTTGCTCGCTGCCCTGTTTTCCCTGCTA
CCATTCATTCTGCGAGGTCTCGCTTGGTATGAATGTATCCCTCGGTATTCTCTCATTGCCGTCAGCGTCTACAAA
CGGTTTTATTTCTTTTTGTTGATCCACGGTTTCTTAATCGTCACGTTGAGTTCTGGAATTACACGGGCGATTCAG
AACATTATTGAGAACCCAGCAAAAACGGTCCAAGAGCTGGCTAGTCAGCTCCCTGGTGCATCAGTATTTTTCCTC
ACTTACATGGTAACGCAGGGCTTGGCAGGTGCTGGGGCAGCACTTGTCCAATTGGCCCCCTTGGCTCTGCACTTC
CTTCGGAAGTGGTTCCTTGGGCGTACCCCGCGCCAAGCATACGGAGTTACCTTTCTCATGCCACATGCTGACTTG
AGTGTGATCTTCCCTCGTCTGTCATTACTTGCCACAATCGGTTTTGCATATAGTGTTTTGTCGCCCCTCATCAAT
CTCCTCGCTTTTATTACTTATCTCACGTACTATTTAGCGTGGAAATTTTTACTATCCCAGGTCATTGACCAACCG
GATGAATTGGAAACCGGCGGCCTTTATTTTCCTATGGCCATCAACAATCTATTTGTCGGCCTTTACATTGAACAA
GTCTCTCTGGCGTGTTTGTTCTTCCTAAAAGCATCCGGTTCGGTTGCGGCTGCTATTGCGCAAGCAGTTCTTATG
CTTGTTCTGTTGTGTATAACCGCTCTGGCACAACTCTTAATCAACCATAGCTTCAACCCCATTATCAAGTACTTA
CCTATGTCCCTGGCGACTCAGCAGGCGACGCGTAGATATGAGAAATATAAGGAAAAGGAAGGACCATCGAACAGT
GATACCGACGATAATGACGTTGATTTATTCAGCCGGACCACGGTTCGCAATGTGCGCAAGCGGACCAAAAAAACA
ACTAAGCAAGTTAAAAACGACCGTGACTCTGTCAAAGTCGATTCCATAAGGGATTCAAGCTCTTCGTGTGATCTT
TTGGAAGGCCTCAACTCGCCTCAGACAAGTGATGATAAAATAGCTGAGGCGTTAGGATTGACAGCAGGGTCAGAA
CTTTACCCTATGAAGTCTCTGAACTCGATTGCGTCGAAGGCTTCATCTATGTCCAAAATATCCCTGGGCCCCAGA
AAATCAAGTAGCAAGGCCTCGAAAAAAAAGGACAAGGCCTTAGGAAAGAAGGGAAAAAGCTTGTTCTTCGATCGA
CATCCTGCCCTGAGTCCTGCCACGGAAGCGCTTACTGATGATTCGGATGACTCGGAAGAAGACGATGCACATGCA
TTTGATCACCCCTCGATATACGTTGAGCAACCTTGGATTTGGATACCCAGAGATCATCTTGGATTGAGTGGATTG
TTGGTGAAGGAGTTGCAGGATGCAGGCGTAAATGCGAGTGATCTTGGTGCAGAGATGCAAGTCAATGGCGTTGTG
GAGGTGACAAGAAACCCGCCTGACGAAGAATGGACCGGAGGGCATGATGCTTGA
Gene >Agabi119p4|043860
ATGGCCGCCGTTGATCCAGGAAAGGCTCTCAGCAGCAGCACGACCCGTAGTTTTGTCACTGCCTTGGTTGTAAAC
GGGGCTCTCCTTGGGGTGGAAGTTCTGGCATTCTTTCTTCTCAAGCAGAAACTGTGGAGAATTTATGGTCCCAGG
ACAGTCCTACCACCTCCACAGTGAGGATGAACTACTTTTTTTTCCAACGTGTGTCGGTTCATCTTATTCCTCTCT
AGTAAACGAGCAGCAGCGTTACCATCTGGAATAGCCAAATGGCTCCCGGCACTTATAAGATACCCAGCGGAAGAT
ATTGTTAGTTTGCCTTTTCCAAACAACGTTCACGGAGTCACTGACAGAGGTGCTCGTAGATACACAAGAATGGAC
TTGATGCGTAAAGTCCATTTTTTTCCCATTCCTCTGGCCGACATTGACAAATCGTGGTCTAGTTATATGTTCCTA
AGATATATCAAACTCCTCATTTGGATTTTTTTGGTCTTCACCCTCTCTACATTCGTCGTTATTATTCCAGCAGAT
GCCGTTGGGATCACATCTGATAAAGAAGGCCTAGAAAGAATATCGTGGACAAAGTAAGTTCATACCTCTGTTCCT
TTTTATTCACTTTAACCTAAAAATTTCAGTATCATTCAACCACGAGATCAAAGCCGATTCAGTGCACATATTGTC
GTTGCCTATGTCTTAACATGTTTGTCGATTTCTACACGTGTCCTTTGAATTTTTCTCATCACCTCGTAGTTTTCG
TAGTGTGGATGATTCGTCGCGAGATGGCCTATTTCGTAAATCTGCGCCACCAATTTCTCATTAGTCCGTCTCATT
CTCGGCTCGCACAAGCTCGTACGGTCTTAATCACTTCTGTACCGGACGAACTGGCCAACGAACGCGATCTCCGCT
CATTCGCAAGTTTCGTACCAGGCGGTGTCGACCGCGTTTGGTTATATCGTGACACACGATCTTTGAATGATGTGT
TCGAGAGGCGACAAGATACATGTCTGAAGTTAGAAGCAGCGGGATCTAGCCTACTTGTCCAGGCAGTTTCAGCTT
GGAGGAAGAAGATCAAACATCATAAGAAAGCCATCAACAGGAAACGAAAGGATGAGGAAGGACTCACTATTTCGA
ATGACTTGGCAATACCGCCACTAACTCGCGCATTTTTGGACGAGCTTGTTCCGCCAGCCAAGCGTCCTCATCATC
GCACTGGTTTTTTGGGGATGATAGGACAAAAAGTTGATACCATTGATTGGTGTACGGTGAGTAGCGCTTAGCTCA
GATTCAAATTTCGTCGTATGATTGATGGGCGATGTTAACAGAAAGAGATCGCGGAATTGAATGGCATTCTGCACA
AGGAAAGGGAAAATATTGTCAAGGGTAAATTCTTGGGAAGTGCATTCATCCGCTGTAATCTTCAGATGGGTGCGC
ATGTTCTGGCGCAATGTGTTAGCTACCATGAAGTTCGTGATTTCTTCCTCGATTCGATGGAATGACTCTGACGAG
AAAAGCCAGCCTTCAACAATGTATTCAAAATGGATGGAAGCTCATCCAAAAGATATAGTTTGGCATAACCTGGAC
GATGGAGCTCTGGAAGTACGGGGGCGATATCTCACTTCGTGGGCGGCGACTGTTGGTCTCATAATTGCATGGGCT
TTTCCTGTCGGTTTCATTGGTACTCTGAGTAATTTAAGTGGCTTTTGTGTCAAATTCCAGTAAGTTAGTTTTCCG
CATCGGGAAACACTTTTGACCTAAGCTCAACACAGCTGGCTTAATTGGTTATGTGCTGGTAGGCTTACCAACTAG
GATCTTCTACTTTGATCTGATCTAACCATATGTACGAGTAGCTCCGAAACCTGTCCTTGGACTCATTCAAGGTGT
TCTTCCTCCTGCCTTGCTCGCTGCCCTGTTTTCCCTGCTACCATTCATTCTGCGAGGTACTGCTGTTTTCATTTG
ATGAGCACCCGCTTATGATTGTTAGGTCTCGCTTGGTATGAATGTATCCCTCGGTATTCTCTCATTGCCGTCAGC
GTCTACAAACGGTTTTATTTCTTTTTGTTGATGTAAGTTTGAATAGGAGACTGTTATCTCTGAAGGCCAGTAATG
CTGCTTGATAGCCACGGTTTCTTAATCGTCACGTTGAGTTCTGGAATTACACGGGCGATTCAGAACGTTCGTCCA
TCAACTATGTCTCCGCCCCTCAATGTAAAACTTGTTCCAGATTATTGAGAACCCAGCAAAAACGGTCCAAGAGCT
GGCTAGTCAGCTCCCTGGTGCATCAGTATTTTTCCTCACTTACATGGGTATGCTCCACGTGTCTTTTAATTCCCT
CCCCCTGGATTTTGACGATACTCATAGTAACGCAGGGCTTGGCAGGTGCTGGGGCAGCACTTGTCCAATTGGCCC
CCTTGGCTCTGCACTTCCTTCGGAAGTGGTTCCTTGGGCGTACCCCGCGCCAAGCATACGGAGTTACCTTTCTCA
TGCCACATGTAAGTGTCTCATCTTTTGTTGAGCATGGTAAAGGATTGTGAACTTTGTATCGCCATAGGCTGACTT
GAGTGTGATCTTCCCTCGTCTGTCATTACTTGCCACAATCGGTTTTGCATATAGTGTTTTGTCGCCCCTCATCAA
TCTCCTCGCTTTTATTAGTAGGTTTCTGCATCATCCAGCCACTTGACACTAACGCCACTTATCAGCTTATCTCAC
GTACTATTTAGCGTGGAAATTTTGTGAGTTTACTGAAACACGTCTGGAGTTCTGGCACAGTTCACTGATAACTTA
CAGTACTATCCCAGGTCATTGACCAACCGGATGAATTGGAAACCGGCGGCCTTTATTTTCCTATGGCCATCAACA
ATCTATGTGAGCAGCGATACAGATTGTTGGCAACCCCCAGCTAATTCGCGTTTTGAGTTGTCGGCCTTTACATTG
AACAAGTCTCTCTGGCGTGTTTGTTCTTCCTAAAAGCATCCGGTTCGGTTGCGGCTGCTATTGCGCAAGCAGTTC
TTATGCTTGTTCTGTTGTGTATAACCGCTCTGGCACAACTCTTAATCAACCATAGCTTCAACCGTGGGTCCTTCA
GTTTACTCTTAACAGACGCTCACGTTTGGCATTTTAGCCATTATCAAGTACTTACCTATGTCCCTGGCGACTCAG
CAGGCGACGCGTAGATATGAGAAATATAAGGAAAAGGAAGGACCATCGAACAGTGATACCGACGATAATGACGTT
GATTTATTCAGCCGGACCAGTGAGCTAGATATACCCGTTGCAGGAGACGCGGTCGTACTCATTTAATCATCAGCG
GTTCGCAATGTGCGCAAGCGGACCAAAAAAACAACTAAGCAAGTTAAAAACGACCGTGACTCTGTCAAAGTCGAT
TCCATAAGGGATTCAAGCTCTTCGTGTGATCTTTTGGAAGGCCTCAACTCGCCTCAGACAAGTGATGATAAAATA
GCTGAGGCGTTAGGATTGACAGCAGGGTCAGAACTTTACCCTATGAAGTCTCTGAACTCGATTGCGTCGAAGGCT
TCATCTATGTCCAAAATATCCCTGGGCCCCAGAAAATCAAGTAGCAAGGCCTCGAAAAAAAAGGACAAGGCCTTA
GGAAAGAAGGGAAAAAGCTTGTTCTTCGATCGACATCCTGCCCTGAGTCCTGCCACGGAAGCGCTTACTGATGAT
TCGGATGACTCGGAAGAAGACGATGCACATGCATTTGATCACCCCTCGATATACGTTGAGCAACCTTGGATTTGG
ATACCCAGAGATCATCTTGGATTGAGTGGATTGTTGGTGAAGGAGTTGCAGGATGCAGGCGTAAATGCGAGTGAT
CTTGGTGCAGAGATGCAAGTCAATGGCGTTGTGGAGGTGACAAGAAACCCGCCTGACGAAGAATGGACCGGAGGG
CATGATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail