Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|043510
Gene name
Locationscaffold_02:1132301..1135881
Strand+
Gene length (bp)3580
Transcript length (bp)3345
Coding sequence length (bp)3345
Protein length (aa) 1115

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.0E-07 27 83
PF13637 Ank_4 Ankyrin repeats (many copies) 4.3E-08 27 75
PF00023 Ank Ankyrin repeat 3.4E-06 54 83
PF00023 Ank Ankyrin repeat 1.5E-02 104 129
PF13606 Ank_3 Ankyrin repeat 1.6E-04 55 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 27 156 2.0E-13
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 27 144 7.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 17 172 4.0E-12
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 17 172 5.0E-12
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 27 167 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 27 156 2.0E-13
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 27 144 7.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 17 172 4.0E-12
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 17 172 5.0E-12
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 27 167 9.0E-12
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 17 156 2.0E-11
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 27 167 2.0E-11
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 27 167 2.0E-11
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 59 234 3.0E-11
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 10 181 4.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 17 159 5.0E-11
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 27 157 5.0E-11
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 27 157 6.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 26 158 7.0E-11
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 27 157 7.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 26 158 8.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 27 179 9.0E-11
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 59 234 9.0E-11
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 27 167 1.0E-10
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 12 158 1.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 27 157 2.0E-10
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 27 148 2.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 27 156 4.0E-10
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 17 171 6.0E-10
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 5 158 7.0E-10
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 59 156 9.0E-10
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 59 169 1.0E-09
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 3 140 1.0E-09
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 29 143 1.0E-09
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 29 143 1.0E-09
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 59 156 1.0E-09
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 2 177 1.0E-09
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 29 143 1.0E-09
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 26 156 1.0E-09
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 59 234 1.0E-09
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 29 143 1.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 27 156 2.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 27 156 2.0E-09
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 26 156 2.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 27 170 2.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 27 144 2.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 27 156 2.0E-09
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 27 156 2.0E-09
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 27 233 2.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 27 159 3.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 27 156 3.0E-09
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 29 177 3.0E-09
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 27 125 3.0E-09
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 59 156 3.0E-09
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 59 169 3.0E-09
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 27 156 4.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 27 159 4.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 27 156 4.0E-09
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 3 140 4.0E-09
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 29 205 4.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 27 144 4.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 27 157 5.0E-09
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 27 156 6.0E-09
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 27 125 6.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 27 164 8.0E-09
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 23 156 8.0E-09
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 23 156 1.0E-08
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 26 156 1.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 23 156 1.0E-08
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 27 156 1.0E-08
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 11 197 2.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 27 156 2.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 27 156 2.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 17 156 2.0E-08
sp|Q5ZLC6|ANR10_CHICK Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 27 158 2.0E-08
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 9 140 2.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 27 157 3.0E-08
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 27 156 3.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 27 157 3.0E-08
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 23 156 3.0E-08
sp|O00522|KRIT1_HUMAN Krev interaction trapped protein 1 OS=Homo sapiens GN=KRIT1 PE=1 SV=2 21 163 3.0E-08
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 26 156 3.0E-08
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 26 156 3.0E-08
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 27 156 4.0E-08
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 19 156 4.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 27 159 4.0E-08
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-08
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 26 156 4.0E-08
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 29 143 4.0E-08
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-08
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 26 151 4.0E-08
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 27 151 4.0E-08
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 11 156 4.0E-08
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 23 156 4.0E-08
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 27 140 4.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 27 154 5.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 27 154 5.0E-08
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 26 156 5.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 27 157 6.0E-08
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 26 156 6.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 26 157 6.0E-08
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 17 166 6.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 27 149 6.0E-08
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 26 156 6.0E-08
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 26 156 6.0E-08
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 27 149 7.0E-08
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 26 156 7.0E-08
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 26 156 7.0E-08
sp|Q6TNJ1|KRIT1_BOVIN Krev interaction trapped protein 1 OS=Bos taurus GN=KRIT1 PE=2 SV=1 21 163 7.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 26 156 8.0E-08
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 26 156 8.0E-08
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 26 156 9.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 27 128 1.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 27 144 1.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 27 128 1.0E-07
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 27 144 1.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 17 156 1.0E-07
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 27 144 1.0E-07
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 26 156 1.0E-07
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 23 156 1.0E-07
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 23 156 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 55 184 1.0E-07
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 55 188 1.0E-07
sp|Q9NXR5|ANR10_HUMAN Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 58 158 1.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 27 144 2.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 17 156 2.0E-07
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 27 161 2.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 27 158 2.0E-07
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 23 156 2.0E-07
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 23 156 2.0E-07
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 12 137 2.0E-07
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 27 205 2.0E-07
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 17 171 2.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 56 156 2.0E-07
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 17 171 2.0E-07
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 27 141 2.0E-07
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 26 156 2.0E-07
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 17 171 2.0E-07
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 27 221 2.0E-07
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 27 190 2.0E-07
sp|Q29Q26|AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana GN=AKR2B PE=1 SV=1 27 157 2.0E-07
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 27 154 2.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 26 156 3.0E-07
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 3 156 3.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 23 156 3.0E-07
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 27 137 3.0E-07
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 26 148 3.0E-07
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 26 148 3.0E-07
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 17 156 3.0E-07
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 27 172 3.0E-07
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 27 167 3.0E-07
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 13 156 3.0E-07
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 27 144 3.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 27 141 3.0E-07
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 27 167 3.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 27 157 3.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 26 153 3.0E-07
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 26 148 3.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 17 156 4.0E-07
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 23 156 4.0E-07
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 23 156 4.0E-07
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 23 156 4.0E-07
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-07
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 59 156 4.0E-07
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 59 164 4.0E-07
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 6 150 4.0E-07
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-07
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-07
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-07
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 27 167 4.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 27 156 5.0E-07
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 23 156 5.0E-07
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 23 156 5.0E-07
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 27 137 5.0E-07
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 23 156 5.0E-07
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 23 156 5.0E-07
sp|F1REV3|KRIT1_DANRE Krev interaction trapped protein 1 OS=Danio rerio GN=krit1 PE=1 SV=1 21 158 5.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 26 153 5.0E-07
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 27 149 5.0E-07
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 59 156 5.0E-07
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 5 201 5.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 27 157 6.0E-07
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 26 156 6.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 26 156 6.0E-07
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 26 156 6.0E-07
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 26 148 6.0E-07
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 11 172 6.0E-07
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 49 145 6.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 27 158 7.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 27 156 7.0E-07
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 27 137 7.0E-07
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 26 156 7.0E-07
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 53 179 7.0E-07
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 4 162 7.0E-07
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 23 156 8.0E-07
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 53 179 8.0E-07
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 23 156 8.0E-07
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 26 148 8.0E-07
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 23 156 9.0E-07
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 23 156 9.0E-07
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 27 141 9.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 55 184 9.0E-07
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 55 148 9.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 27 144 1.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 3 194 1.0E-06
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 7 179 1.0E-06
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 26 156 1.0E-06
sp|Q0VC93|ANR37_BOVIN Ankyrin repeat domain-containing protein 37 OS=Bos taurus GN=ANKRD37 PE=2 SV=1 36 202 1.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 24 150 1.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 5 140 1.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 27 205 1.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 10 156 1.0E-06
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 56 171 1.0E-06
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 47 151 1.0E-06
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 4 162 1.0E-06
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 27 167 1.0E-06
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 26 148 1.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 27 156 2.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 27 156 2.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 27 156 2.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 26 156 2.0E-06
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 23 156 2.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 59 162 2.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 59 162 2.0E-06
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 27 137 2.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 3 208 2.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 27 156 2.0E-06
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 23 152 2.0E-06
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 26 156 2.0E-06
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 26 156 2.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 27 130 2.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 23 156 2.0E-06
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 27 156 2.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 27 156 2.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 40 140 2.0E-06
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 27 156 2.0E-06
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 34 144 2.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 43 153 2.0E-06
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 25 156 2.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 26 156 2.0E-06
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 55 145 2.0E-06
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 7 151 2.0E-06
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 7 172 2.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 25 145 2.0E-06
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 59 156 2.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 14 156 3.0E-06
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 27 144 3.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 27 156 3.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 27 159 3.0E-06
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 27 156 3.0E-06
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 27 148 3.0E-06
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 27 148 3.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 15 156 3.0E-06
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 27 130 3.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 23 156 3.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 23 156 3.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 23 156 3.0E-06
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 59 156 3.0E-06
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 23 156 3.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 4 162 3.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 27 156 3.0E-06
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 34 140 3.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 10 156 3.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 27 148 3.0E-06
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 39 144 3.0E-06
sp|Q9D119|PPR27_MOUSE Protein phosphatase 1 regulatory subunit 27 OS=Mus musculus GN=Ppp1r27 PE=2 SV=1 55 143 3.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 27 128 4.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 27 146 4.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 27 144 4.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 27 156 4.0E-06
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 27 156 4.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 27 170 4.0E-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 26 156 4.0E-06
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 39 128 4.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 27 221 4.0E-06
sp|Q99LW0|ANR10_MOUSE Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 27 156 4.0E-06
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 27 179 4.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 27 225 4.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 27 165 5.0E-06
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 27 157 5.0E-06
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 1 158 5.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 26 144 5.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 27 221 5.0E-06
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 30 172 5.0E-06
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 27 130 6.0E-06
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 17 140 6.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 54 156 6.0E-06
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 27 126 6.0E-06
sp|B4E2M5|ANR66_HUMAN Ankyrin repeat domain-containing protein 66 OS=Homo sapiens GN=ANKRD66 PE=2 SV=2 27 157 6.0E-06
sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 27 145 6.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 26 148 7.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 40 144 7.0E-06
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 27 227 7.0E-06
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 56 157 7.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 26 148 8.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 27 156 8.0E-06
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 27 156 8.0E-06
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 27 213 8.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 27 158 9.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 6 156 9.0E-06
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 27 158 9.0E-06
sp|P55273|CDN2D_HUMAN Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens GN=CDKN2D PE=1 SV=1 58 161 9.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 27 156 1.0E-05
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 27 128 1.0E-05
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 26 144 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|043510
MPVPLRAVHHRGEAKHNVTTDFPSLGLHSAASTGNVGLVEYALSRGQPVNSVVDGVLPLHAACAGGNVQVVKLLI
EYGADVNAPRLSKRYSSRDSSAPIIGTTGSTPLHFAAANGNRDAIMLLLLHGAHADRADKHGVTPENLARQNGWI
ECADLLKNWIINKDKDLREREEFVVADDKDIAKRRNRLGSFGDEQSLTGRRRLHVKHSIDTALNMLKSSSSNLSE
LYRGPHTPTPPTSPTKPFGDFASQLTNYNGERSSSRRPSLPHIGQPDASTRLRNSSFQSANPHQANSAGEDGEES
STNPSHNKVYCARKKGSKVSLLNLFRKGQNSESSSTPDLNASTVSVINDTTTLSASPPSGHIPRRSRPHQGSDAS
SRSRRAGDFPVERKSSLNSPVRSTSDNNTPTLRQSNRDRSRSNASSQYNDDPIISGSYNSPGSSPLARLGMLRHQ
GHHRTRSGSGSSSGYDANVPSRLGAASTVAPDDASINRGVTNADLENLSRSLPRTGIFKPHNRNGSNGQGHMNPS
ALRAVSRNTTSHSLSPRSNPARLKSSDSSNSLVRSDSYSRRRASLRPGSAGSMSGSKLNIEEEEGEEEYGRPIEP
TKTSLLIGAGETPASRSPLSPIISDGHVAGEQDEETSQFPFSINQPPPLPVEGEIDFTPSHLTHHAADNRHRGSS
LSSTDSRGFTQSPTSIASAVMITPPLMGSGGIPHRDKQLEALGSRAGLMEGDDEDIRSYVASDAVSKSLIRRSPS
LPKGMSLDQMDSNRDSTSTLVLASATPLSNGNLNGRRSHTPYEIDLTSISTHAQAEALVEQTRNKVMELASSEDH
DIVSTPGSDGRTPLSARLAAYGESLALERKFREQENGVVNVTSGYTAGTLLTNGKRNGVSSRTSLLLPIANQHSR
EGSGYSSSLYSGRSAIAIKETPSRRSVDDVWNGRHVRRPSTAEGLASREVNMSRSSEQSDWSSPSARSVSALGYR
RTEAGNYEQHSGPIVNLLSSSATDDHPMHHKTSSSQGFYGRSNASPPGYENNVTIGLRMASLDGADFDKGDHPGV
PLYRVSTTPTPVPRLPPPQGPGRSLKKLSKMGISIADQAGRGAQPPPAHGKKFNLKYFFKGNKG*
Coding >Agabi119p4|043510
ATGCCCGTTCCCCTCCGGGCGGTCCACCATCGGGGCGAGGCCAAGCACAACGTCACCACCGACTTTCCAAGTCTT
GGTCTCCATTCTGCAGCCTCCACCGGCAACGTGGGCCTTGTCGAATACGCCCTCTCACGCGGCCAGCCAGTCAAC
TCGGTTGTAGATGGCGTACTCCCTCTTCATGCTGCCTGTGCCGGAGGCAATGTTCAAGTTGTCAAACTCCTTATC
GAATATGGTGCAGATGTGAACGCCCCAAGGCTTTCAAAGCGCTATTCCAGCAGAGACTCTTCTGCACCCATCATC
GGAACTACGGGCTCAACTCCCCTCCACTTTGCCGCCGCAAACGGTAACAGGGATGCCATTATGCTTCTCCTACTC
CATGGTGCACATGCAGACCGTGCAGACAAACATGGCGTTACCCCCGAAAACCTTGCCCGGCAGAATGGCTGGATT
GAATGTGCTGATCTTCTAAAAAACTGGATCATAAACAAGGATAAAGACTTGAGAGAGAGGGAAGAATTCGTCGTC
GCAGATGACAAAGACATTGCGAAACGTCGTAACCGATTAGGCTCCTTCGGTGACGAACAATCATTAACCGGTCGT
CGCCGCCTCCACGTCAAGCATTCCATTGATACGGCCCTCAACATGCTCAAATCCTCGTCATCCAATCTCTCGGAA
CTCTATCGAGGCCCGCATACGCCCACTCCTCCCACTTCTCCTACTAAACCCTTCGGCGATTTCGCCTCTCAACTC
ACAAATTATAATGGCGAGCGGTCATCCAGTCGACGTCCTTCACTACCCCACATTGGACAACCGGATGCGTCAACT
CGCCTGAGAAACTCTTCTTTCCAGTCAGCAAATCCTCACCAAGCGAATTCTGCAGGCGAAGATGGTGAAGAAAGC
AGCACCAACCCATCTCATAACAAAGTCTATTGTGCACGAAAAAAAGGAAGCAAAGTTTCATTGCTCAATCTCTTT
CGCAAAGGGCAAAATTCTGAAAGCTCAAGCACACCGGACCTCAACGCAAGCACAGTCTCTGTAATTAATGACACC
ACAACGCTCTCAGCTTCTCCGCCATCTGGTCATATCCCTCGCCGTTCGCGTCCACATCAGGGAAGTGATGCTTCC
AGTCGATCAAGAAGAGCGGGGGACTTCCCTGTGGAGCGAAAGTCTTCCCTCAACTCCCCTGTACGTTCGACAAGT
GACAACAATACGCCGACGCTTAGGCAGTCCAACCGCGATCGTTCGAGGTCAAACGCTAGTAGTCAATATAACGAC
GATCCTATCATATCTGGCAGCTATAATAGCCCTGGCTCTAGTCCACTTGCTCGACTCGGTATGCTTCGACATCAA
GGCCATCACAGAACACGTTCGGGGTCCGGGAGCAGTTCGGGTTACGATGCGAATGTACCCTCGCGTCTTGGAGCA
GCATCAACAGTTGCGCCAGATGATGCATCAATCAACCGAGGAGTCACCAACGCTGATTTAGAAAATTTGTCGAGG
TCCCTGCCGCGTACAGGTATTTTCAAGCCACACAATCGCAATGGATCGAATGGTCAAGGTCACATGAACCCTTCC
GCGCTGAGGGCCGTAAGTCGCAACACAACCTCTCATTCGTTATCTCCCCGAAGTAACCCTGCCCGACTAAAATCG
AGCGATAGCTCAAATTCACTCGTACGATCGGATTCGTATTCGAGACGACGCGCGAGTCTCAGACCCGGAAGTGCT
GGCTCGATGTCAGGTTCGAAACTGAATATAGAGGAGGAGGAAGGCGAAGAAGAGTATGGCAGGCCAATCGAGCCC
ACAAAGACATCTTTGTTGATTGGAGCTGGAGAAACCCCTGCTTCGAGATCTCCACTTTCACCTATCATATCGGAT
GGTCACGTCGCTGGAGAACAAGACGAAGAAACATCACAATTTCCTTTCAGTATCAACCAGCCACCCCCGCTACCC
GTCGAAGGAGAGATCGACTTTACTCCATCCCACCTTACACATCATGCCGCAGACAATAGACATAGAGGAAGTTCA
CTCAGCAGTACGGACAGCCGAGGGTTCACACAGTCTCCGACTAGCATAGCGAGCGCTGTGATGATTACGCCACCC
CTCATGGGGTCCGGAGGAATACCCCATCGGGACAAGCAATTGGAAGCTTTGGGTTCGAGAGCAGGACTGATGGAG
GGTGACGATGAAGACATTCGATCGTATGTCGCCTCAGATGCAGTATCCAAATCTCTTATACGACGAAGTCCATCT
CTGCCAAAGGGAATGTCTCTGGACCAAATGGACTCTAATCGTGATTCAACTTCAACTCTCGTCTTGGCCTCTGCT
ACACCTCTAAGCAATGGAAATCTGAATGGACGAAGATCCCACACGCCATATGAAATCGACCTCACTTCAATATCC
ACCCATGCTCAGGCGGAAGCTCTCGTTGAGCAAACAAGGAATAAAGTTATGGAGTTAGCAAGCTCAGAGGACCAC
GATATTGTTTCTACGCCTGGCAGTGACGGCCGAACACCATTAAGTGCGCGACTAGCCGCATATGGTGAGAGCCTT
GCATTAGAGAGAAAATTCAGAGAACAGGAGAATGGGGTTGTGAATGTTACGAGTGGCTACACCGCTGGTACGTTG
CTGACGAACGGGAAGAGGAACGGAGTGAGCAGTCGTACGAGTTTGCTGCTACCGATTGCGAATCAACATTCAAGA
GAAGGCTCAGGATATTCGAGTTCGTTATATAGCGGAAGGAGTGCTATTGCAATCAAAGAGACTCCATCTCGTCGG
TCTGTTGATGATGTATGGAATGGTAGGCATGTGAGGAGGCCATCAACAGCGGAAGGATTGGCTTCGCGAGAGGTG
AACATGTCGCGTTCCAGTGAGCAATCAGACTGGTCCTCGCCGTCTGCGAGATCCGTGTCCGCACTAGGTTATCGA
CGTACGGAAGCAGGCAATTACGAACAACATTCGGGACCTATCGTCAACCTCCTATCCTCGAGCGCCACAGATGAC
CATCCCATGCACCACAAAACAAGTTCAAGCCAAGGTTTCTATGGAAGGTCCAATGCATCCCCACCTGGTTATGAA
AATAATGTGACGATAGGACTCAGAATGGCCTCATTGGACGGGGCAGACTTTGATAAGGGTGACCATCCCGGAGTA
CCGCTTTATAGAGTCTCGACGACGCCTACACCTGTCCCGAGGTTGCCTCCCCCTCAGGGTCCAGGACGAAGCTTA
AAGAAATTATCCAAAATGGGGATATCCATTGCTGACCAGGCGGGAAGGGGTGCACAACCTCCACCCGCTCATGGA
AAGAAATTTAATCTCAAATACTTTTTCAAAGGCAACAAAGGTTAA
Transcript >Agabi119p4|043510
ATGCCCGTTCCCCTCCGGGCGGTCCACCATCGGGGCGAGGCCAAGCACAACGTCACCACCGACTTTCCAAGTCTT
GGTCTCCATTCTGCAGCCTCCACCGGCAACGTGGGCCTTGTCGAATACGCCCTCTCACGCGGCCAGCCAGTCAAC
TCGGTTGTAGATGGCGTACTCCCTCTTCATGCTGCCTGTGCCGGAGGCAATGTTCAAGTTGTCAAACTCCTTATC
GAATATGGTGCAGATGTGAACGCCCCAAGGCTTTCAAAGCGCTATTCCAGCAGAGACTCTTCTGCACCCATCATC
GGAACTACGGGCTCAACTCCCCTCCACTTTGCCGCCGCAAACGGTAACAGGGATGCCATTATGCTTCTCCTACTC
CATGGTGCACATGCAGACCGTGCAGACAAACATGGCGTTACCCCCGAAAACCTTGCCCGGCAGAATGGCTGGATT
GAATGTGCTGATCTTCTAAAAAACTGGATCATAAACAAGGATAAAGACTTGAGAGAGAGGGAAGAATTCGTCGTC
GCAGATGACAAAGACATTGCGAAACGTCGTAACCGATTAGGCTCCTTCGGTGACGAACAATCATTAACCGGTCGT
CGCCGCCTCCACGTCAAGCATTCCATTGATACGGCCCTCAACATGCTCAAATCCTCGTCATCCAATCTCTCGGAA
CTCTATCGAGGCCCGCATACGCCCACTCCTCCCACTTCTCCTACTAAACCCTTCGGCGATTTCGCCTCTCAACTC
ACAAATTATAATGGCGAGCGGTCATCCAGTCGACGTCCTTCACTACCCCACATTGGACAACCGGATGCGTCAACT
CGCCTGAGAAACTCTTCTTTCCAGTCAGCAAATCCTCACCAAGCGAATTCTGCAGGCGAAGATGGTGAAGAAAGC
AGCACCAACCCATCTCATAACAAAGTCTATTGTGCACGAAAAAAAGGAAGCAAAGTTTCATTGCTCAATCTCTTT
CGCAAAGGGCAAAATTCTGAAAGCTCAAGCACACCGGACCTCAACGCAAGCACAGTCTCTGTAATTAATGACACC
ACAACGCTCTCAGCTTCTCCGCCATCTGGTCATATCCCTCGCCGTTCGCGTCCACATCAGGGAAGTGATGCTTCC
AGTCGATCAAGAAGAGCGGGGGACTTCCCTGTGGAGCGAAAGTCTTCCCTCAACTCCCCTGTACGTTCGACAAGT
GACAACAATACGCCGACGCTTAGGCAGTCCAACCGCGATCGTTCGAGGTCAAACGCTAGTAGTCAATATAACGAC
GATCCTATCATATCTGGCAGCTATAATAGCCCTGGCTCTAGTCCACTTGCTCGACTCGGTATGCTTCGACATCAA
GGCCATCACAGAACACGTTCGGGGTCCGGGAGCAGTTCGGGTTACGATGCGAATGTACCCTCGCGTCTTGGAGCA
GCATCAACAGTTGCGCCAGATGATGCATCAATCAACCGAGGAGTCACCAACGCTGATTTAGAAAATTTGTCGAGG
TCCCTGCCGCGTACAGGTATTTTCAAGCCACACAATCGCAATGGATCGAATGGTCAAGGTCACATGAACCCTTCC
GCGCTGAGGGCCGTAAGTCGCAACACAACCTCTCATTCGTTATCTCCCCGAAGTAACCCTGCCCGACTAAAATCG
AGCGATAGCTCAAATTCACTCGTACGATCGGATTCGTATTCGAGACGACGCGCGAGTCTCAGACCCGGAAGTGCT
GGCTCGATGTCAGGTTCGAAACTGAATATAGAGGAGGAGGAAGGCGAAGAAGAGTATGGCAGGCCAATCGAGCCC
ACAAAGACATCTTTGTTGATTGGAGCTGGAGAAACCCCTGCTTCGAGATCTCCACTTTCACCTATCATATCGGAT
GGTCACGTCGCTGGAGAACAAGACGAAGAAACATCACAATTTCCTTTCAGTATCAACCAGCCACCCCCGCTACCC
GTCGAAGGAGAGATCGACTTTACTCCATCCCACCTTACACATCATGCCGCAGACAATAGACATAGAGGAAGTTCA
CTCAGCAGTACGGACAGCCGAGGGTTCACACAGTCTCCGACTAGCATAGCGAGCGCTGTGATGATTACGCCACCC
CTCATGGGGTCCGGAGGAATACCCCATCGGGACAAGCAATTGGAAGCTTTGGGTTCGAGAGCAGGACTGATGGAG
GGTGACGATGAAGACATTCGATCGTATGTCGCCTCAGATGCAGTATCCAAATCTCTTATACGACGAAGTCCATCT
CTGCCAAAGGGAATGTCTCTGGACCAAATGGACTCTAATCGTGATTCAACTTCAACTCTCGTCTTGGCCTCTGCT
ACACCTCTAAGCAATGGAAATCTGAATGGACGAAGATCCCACACGCCATATGAAATCGACCTCACTTCAATATCC
ACCCATGCTCAGGCGGAAGCTCTCGTTGAGCAAACAAGGAATAAAGTTATGGAGTTAGCAAGCTCAGAGGACCAC
GATATTGTTTCTACGCCTGGCAGTGACGGCCGAACACCATTAAGTGCGCGACTAGCCGCATATGGTGAGAGCCTT
GCATTAGAGAGAAAATTCAGAGAACAGGAGAATGGGGTTGTGAATGTTACGAGTGGCTACACCGCTGGTACGTTG
CTGACGAACGGGAAGAGGAACGGAGTGAGCAGTCGTACGAGTTTGCTGCTACCGATTGCGAATCAACATTCAAGA
GAAGGCTCAGGATATTCGAGTTCGTTATATAGCGGAAGGAGTGCTATTGCAATCAAAGAGACTCCATCTCGTCGG
TCTGTTGATGATGTATGGAATGGTAGGCATGTGAGGAGGCCATCAACAGCGGAAGGATTGGCTTCGCGAGAGGTG
AACATGTCGCGTTCCAGTGAGCAATCAGACTGGTCCTCGCCGTCTGCGAGATCCGTGTCCGCACTAGGTTATCGA
CGTACGGAAGCAGGCAATTACGAACAACATTCGGGACCTATCGTCAACCTCCTATCCTCGAGCGCCACAGATGAC
CATCCCATGCACCACAAAACAAGTTCAAGCCAAGGTTTCTATGGAAGGTCCAATGCATCCCCACCTGGTTATGAA
AATAATGTGACGATAGGACTCAGAATGGCCTCATTGGACGGGGCAGACTTTGATAAGGGTGACCATCCCGGAGTA
CCGCTTTATAGAGTCTCGACGACGCCTACACCTGTCCCGAGGTTGCCTCCCCCTCAGGGTCCAGGACGAAGCTTA
AAGAAATTATCCAAAATGGGGATATCCATTGCTGACCAGGCGGGAAGGGGTGCACAACCTCCACCCGCTCATGGA
AAGAAATTTAATCTCAAATACTTTTTCAAAGGCAACAAAGGTTAA
Gene >Agabi119p4|043510
ATGCCCGTTCCCCTCCGGGCGGTCCACCATCGGGGCGAGGCCAAGCACAACGTCACCACCGACTGTGAGTTTTTC
TACTCGTTGGCTCGCTCTGTCTGAGTATATGTCCCAGTTCCAAGTCTTGGTCTCCATTCTGCAGCCTCCACCGGC
AACGTGGGCCTTGTCGAATACGCCCTCTCACGCGGCCAGCCAGTCAACTCGGTTGTAGATGGCGTACTCCCTCTT
CATGCTGCCTGTGCCGGAGGCAATGTTCAAGTTGTCAAACTCCTTATCGAATATGGTGCAGATGTGAACGCCCCA
AGGTAAGCTTCTCGCTTTATCAGCCCTATTCATTTCCCGCACCTATCTCATTGACGCCATTTTTACCCCACATTG
CCTTCTGCAGGCTTTCAAAGCGCTATTCCAGCAGAGACTCTTCTGCACCCATCATCGGAACTACGGGCTCAACTC
CCCTCCACTTTGCCGCCGCAAACGGTAACAGGGATGCCATTATGCTTCTCCTACTCCATGGTGCACATGCAGACC
GTGCAGACAAACATGGCGTTACCCCCGAAAACCTTGCCCGGCAGAATGGCTGGATTGAATGTGCTGATCTTCTAA
AAAACTGGATCATAAACAAGGATAAAGACTTGAGAGAGAGGGAAGAATTCGTCGTCGCAGATGACAAAGACATTG
CGAAACGTCGTAACCGATTAGGCTCCTTCGGTGACGAACAATCATTAACCGGTCGTCGCCGCCTCCACGTCAAGC
ATTCCATTGATACGGCCCTCAACATGCTCAAATCCTCGTCATCCAATCTCTCGGAACTCTATCGAGGCCCGCATA
CGCCCACTCCTCCCACTTCTCCTACTAAACCCTTCGGCGATTTCGCCTCTCAACTCACAAATTATAATGGCGAGC
GGTCATCCAGTCGACGTCCTTCACTACCCCACATTGGACAACCGGATGCGTCAACTCGCCTGAGAAACTCTTCTT
TCCAGTCAGCAAATCCTCACCAAGCGAATTCTGCAGGCGAAGATGGTGAAGAAAGCAGCACCAACCCATCTCATA
ACAAAGTCTATTGTGCACGAAAAAAAGGAAGCAAAGTTTCATTGCTCAATCTCTTTCGCAAAGGGCAAAATTCTG
AAAGCTCAAGCACACCGGACCTCAACGCAAGCACAGTCTCTGTAATTAATGACACCACAACGCTCTCAGCTTCTC
CGCCATCTGGTCATATCCCTCGCCGTTCGCGTCCACATCAGGGAAGTGATGCTTCCAGTCGATCAAGAAGAGCGG
GGGACTTCCCTGTGGAGCGAAAGTCTTCCCTCAACTCCCCTGTACGTTCGACAAGTGACAACAATACGCCGACGC
TTAGGCAGTCCAACCGCGATCGTTCGAGGTCAAACGCTAGTAGTCAATATAACGACGATCCTATCATATCTGGCA
GCTATAATAGCCCTGGCTCTAGTCCACTTGCTCGACTCGGTATGCTTCGACATCAAGGCCATCACAGAACACGTT
CGGGGTCCGGGAGCAGTTCGGGTTACGATGCGAATGTACCCTCGCGTCTTGGAGCAGCATCAACAGTTGCGCCAG
ATGATGCATCAATCAACCGAGGAGTCACCAACGCTGATTTAGAAAATTTGTCGAGGTCCCTGCCGCGTACAGGTA
TTTTCAAGCCACACAATCGCAATGGATCGAATGGTCAAGGTCACATGAACCCTTCCGCGCTGAGGGCCGTAAGGT
ATGATGTGTCGTCGTTCAAAAAAGACTCACGAGAAAGTCATACTCGCAGTCGCAACACAACCTCTCATTCGTTAT
CTCCCCGAAGTAACCCTGCCCGACTAAAATCGAGCGATAGCTCAAATTCACTCGTACGATCGGATTCGTATTCGA
GACGACGCGCGAGTCTCAGACCCGGAAGTGCTGGCTCGATGTCAGGTTCGAAACTGAATATAGAGGAGGAGGAAG
GCGAAGAAGAGTATGGCAGGCCAATCGAGCCCACAAAGACATCTTTGTTGATTGGAGCTGGAGAAACCCCTGCTT
CGAGATCTCCACTTTCACCTATCATATCGGATGGTCACGTCGCTGGAGAACAAGACGAAGAAACATCACAATTTC
CTTTCAGTATCAACCAGCCACCCCCGCTACCCGTCGAAGGAGAGATCGACTTTACTCCATCCCACCTTACACATC
ATGCCGCAGACAATAGACATAGAGGAAGTTCACTCAGCAGTACGGACAGCCGAGGGTTCACACAGTCTCCGACTA
GCATAGCGAGCGCTGTGATGATTACGCCACCCCTCATGGGGTCCGGAGGAATACCCCATCGGGACAAGCAATTGG
AAGCTTTGGGTTCGAGAGCAGGACTGATGGAGGGTGACGATGAAGACATTCGATCGTATGTCGCCTCAGATGCAG
TATCCAAATCTCTTATACGACGAAGTCCATCTCTGCCAAAGGGAATGTCTCTGGACCAAATGGACTCTAATCGTG
ATTCAACTTCAACTCTCGTCTTGGCCTCTGCTACACCTCTAAGCAATGGAAATCTGAATGGACGAAGATCCCACA
CGCCATATGAAATCGACCTCACTTCAATATCCACCCATGCTCAGGCGGAAGCTCTCGTTGAGCAAACAAGGAATA
AAGTTATGGAGTTAGCAAGCTCAGAGGACCACGATATTGTTTCTACGCCTGGCAGTGACGGCCGAACACCATTAA
GTGCGCGACTAGCCGCATATGGTGAGAGCCTTGCATTAGAGAGAAAATTCAGAGAACAGGAGAATGGGGTTGTGA
ATGTTACGAGTGGCTACACCGCTGGTACGTTGCTGACGAACGGGAAGAGGAACGGAGTGAGCAGTCGTACGAGTT
TGCTGCTACCGATTGCGAATCAACATTCAAGAGAAGGCTCAGGATATTCGAGTTCGTTATATAGCGGAAGGAGTG
CTATTGCAATCAAAGAGACTCCATCTCGTCGGTCTGTTGATGATGTATGGAATGGTAGGCATGTGAGGAGGCCAT
CAACAGCGGAAGGATGTAAGCGGCATAGTTCATATTATCGCTGATTTTTATCTGATCATGGGACACAGTGGCTTC
GCGAGAGGTGAACATGTCGCGTTCCAGTGAGCAATCAGACTGGTCCTCGCCGTCTGCGAGATCCGTGTCCGCACT
AGGTTATCGACGTACGGAAGCAGGCAATTACGAACAACATTCGGGACCTATCGTCAACCTCCTATCCTCGAGCGC
CACAGATGACCATCCCATGCACCACAAAACAAGTTCAAGCCAAGGTTTCTATGGAAGGTCCAATGCATCCCCACC
TGGTTATGAAAATAATGTGACGATAGGACTCAGAATGGCCTCATTGGACGGGGCAGACTTTGATAAGGGTGACCA
TCCCGGAGTACCGCTTTATAGAGTCTCGACGACGCCTACACCTGTCCCGAGGTTGCCTCCCCCTCAGGGTCCAGG
ACGAAGCTTAAAGAAATTATCCAAAATGGGGATATCCATTGCTGACCAGGCGGGAAGGGGTGCACAACCTCCACC
CGCTCATGGAAAGAAATTTAATCTCAAATACTTTTTCAAAGGCAACAAAGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail