Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|043140
Gene name
Locationscaffold_02:1033779..1038048
Strand+
Gene length (bp)4269
Transcript length (bp)3741
Coding sequence length (bp)3741
Protein length (aa) 1247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08161 NUC173 NUC173 domain 1.1E-56 379 590

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0X8|RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp12 PE=3 SV=1 9 1172 1.0E-123
sp|Q12754|RRP12_YEAST Ribosomal RNA-processing protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP12 PE=1 SV=1 1 1164 3.0E-122
sp|Q5ZKD5|RRP12_CHICK RRP12-like protein OS=Gallus gallus GN=RRP12 PE=2 SV=1 4 1237 2.0E-83
sp|Q5JTH9|RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP12 PE=1 SV=2 4 1132 5.0E-64
sp|Q6P5B0|RRP12_MOUSE RRP12-like protein OS=Mus musculus GN=Rrp12 PE=1 SV=1 4 1239 3.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0X8|RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp12 PE=3 SV=1 9 1172 1.0E-123
sp|Q12754|RRP12_YEAST Ribosomal RNA-processing protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP12 PE=1 SV=1 1 1164 3.0E-122
sp|Q5ZKD5|RRP12_CHICK RRP12-like protein OS=Gallus gallus GN=RRP12 PE=2 SV=1 4 1237 2.0E-83
sp|Q5JTH9|RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP12 PE=1 SV=2 4 1132 5.0E-64
sp|Q6P5B0|RRP12_MOUSE RRP12-like protein OS=Mus musculus GN=Rrp12 PE=1 SV=1 4 1239 3.0E-63
sp|Q9VYA7|RRP12_DROME RRP12-like protein OS=Drosophila melanogaster GN=CG2691 PE=1 SV=2 14 1239 5.0E-36
sp|Q9Y824|YON1_SCHPO Uncharacterized protein C1105.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.01 PE=1 SV=2 737 1016 1.0E-31
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|043140
MEDTLAKIRVHKSSAAPAHKTPATLLIAVESTLQEQNKDRSPTAYFAALLTTLDGTLQHKDLSLDEGAVLPAELY
LISLVTPFVSKLVIRAHLGTLLNLTAPLFPLVTSHTAPLRSQLSIYHVLFQSLDLSQLDTPTLPQTFASILNLCL
DSRPKIRRKAADVVKATLCNPPNPLTRHPYAGRAAEFVKLTLGELASAPFAKGKSKETGNRPEDAIHVLAFLRPV
LTYFPPAVVPEITTLLLSLPRLGNSYLTQTSYSILSDLFSLPDEDEECSFSSQLPEMLLAILSSPPVKTDATVSP
AWVQVLGDAMRVYNVVDTDACGKELSRVWKAVWNFIDSNDLETRKSAAHSLSKLSQCFPTSLILTAVADPQGSSK
ITKIISQVTLALENIAYARSIPEILVVISNLFIGLKYRPSRVSPSAAETLMLPLISQVGDLRTRRDFEFKEDADA
TLRVAMQVLGPEVLLRVLPLNLEPEKRKAGGEPRAYLLPLLAQPHPSPLRHFISYFVPLSERIFDLQQAAESEGR
ASEAKVWSVLVGQIWAGLVGYCHAPIDLKEALSPTFAQLLSQLLYSQSELRPAILRALTIIVESNQTPADDSQMM
SAGTASPEELTTNLDFLRTQADSWLAVLFNVFGSVIPESRSTVADVIKTWASIADEQVITGAYTKVIALFRANLA
SAQNAPSTANSSSEAGSATAMTQDILILLLPYLSQADAQALFELCLKSEVLSGKDNGVQKRGYKILAKLLEEDRV
KVDVIAVLKTLDELSIGLTSAAKKDRFNLLSAAIRHLPSSALHVIPSIIPEAVLGTKEPSEKARGAAFELILAMG
RKMSVGGIVRRDMVDGMDEDVDGEAAANIEEYMTMIAGGLAGASPHMISATVTAISRLVFEFKDSISSKMHTEIL
QTLLVFINSANREIVKSVLGFVKLVIHTLPTELVRPHLSELVPSLLNWSHDHNNHFKVKVRHIFERLLRRFSWEE
VYSCAGNDEAGKVLLNVKKRKDRAKRKRAAREEAGESDDATQDRKHVAGDAFEDVLYGSESELEDSDDEATPTTK
NKNKAGRKKGAGPSAHLRLDDDEPMDLLQGAAGHVTGAKSSRRRQPGQDATHFKTDEKTGKLIIDKESDFGNAGE
DGNGEDEVIVGNAYKESMTSVDGFTRGAGGRIKFNKDTKKRRREEIERDDDVEMADAENISAGKKSKKIGKSEPR
LGHEFKAKRAGGDVKKHGLDPYAYLSLSEAAKRKQGNKRIGIASKR*
Coding >Agabi119p4|043140
ATGGAGGACACTCTGGCCAAGATCAGAGTCCACAAATCCTCTGCAGCACCAGCCCACAAAACCCCGGCCACATTG
CTCATAGCCGTAGAGTCAACCCTCCAGGAGCAGAACAAAGATCGTTCTCCCACCGCTTACTTTGCTGCGCTGCTT
ACCACCCTCGATGGCACCCTCCAACACAAGGATCTTAGTCTGGACGAAGGCGCCGTTCTACCTGCCGAATTGTAC
CTCATCTCTCTCGTTACTCCCTTCGTATCGAAACTGGTCATTCGTGCTCATCTCGGCACTTTACTCAACCTGACT
GCCCCACTCTTTCCTTTGGTGACATCTCACACCGCACCATTGCGCTCACAATTGTCAATATATCATGTTTTGTTC
CAATCGTTAGATCTATCACAGCTCGACACACCGACTCTTCCACAGACATTTGCTTCCATCTTGAATCTATGTCTC
GATTCACGACCAAAAATTCGCAGAAAAGCTGCCGACGTCGTCAAGGCTACACTCTGCAACCCACCGAACCCGCTC
ACTCGTCATCCATATGCGGGGAGAGCCGCTGAATTTGTAAAACTCACTTTGGGCGAGTTAGCCTCGGCTCCCTTT
GCTAAAGGCAAATCAAAAGAAACCGGTAATCGACCGGAGGATGCAATCCATGTACTTGCTTTTCTCAGACCTGTC
CTCACATATTTTCCACCCGCTGTTGTCCCAGAAATAACTACTCTCCTCCTCAGTCTCCCTCGCCTTGGTAACTCT
TACCTGACCCAAACATCTTACTCCATCTTATCCGATCTGTTCTCCCTTCCGGATGAGGATGAGGAATGCTCATTC
AGTAGTCAGCTTCCTGAAATGCTGCTCGCCATCCTCTCTTCCCCACCGGTCAAAACCGATGCCACAGTCTCACCC
GCATGGGTACAAGTTTTGGGTGATGCCATGCGGGTGTACAATGTTGTTGATACCGATGCATGTGGTAAAGAGTTG
AGTAGGGTTTGGAAGGCTGTGTGGAATTTCATTGACTCGAATGACCTTGAGACGCGAAAGAGTGCTGCGCACTCT
CTTAGCAAACTTAGCCAATGTTTCCCAACTTCTCTCATCTTGACCGCGGTTGCGGACCCCCAGGGGTCGTCGAAA
ATTACTAAAATCATTTCCCAGGTCACGCTAGCACTCGAAAATATTGCGTATGCTCGCTCGATCCCCGAAATACTA
GTCGTCATATCCAACCTCTTCATAGGACTGAAATACAGGCCATCAAGGGTGTCGCCCTCCGCTGCGGAGACATTG
ATGCTCCCTCTTATCTCCCAAGTAGGAGATCTTCGTACTCGGCGAGACTTCGAATTCAAAGAGGATGCGGACGCT
ACACTTAGAGTTGCGATGCAAGTCCTTGGTCCCGAGGTCTTACTACGCGTGTTACCCCTCAACCTCGAGCCGGAG
AAACGGAAAGCTGGAGGAGAACCACGTGCATACCTCCTTCCACTTCTAGCCCAGCCACATCCCTCTCCTCTCAGA
CATTTCATCTCTTATTTCGTTCCTCTCAGTGAAAGAATATTTGACCTCCAGCAAGCTGCTGAATCAGAGGGACGT
GCGTCGGAGGCCAAGGTCTGGAGCGTGCTCGTTGGTCAAATCTGGGCAGGGTTGGTGGGTTATTGTCACGCCCCC
ATTGATTTGAAAGAGGCGCTCAGCCCCACCTTTGCACAACTCCTCTCACAGCTACTCTATTCTCAAAGCGAGCTC
CGCCCAGCAATTCTCAGAGCGCTTACCATCATTGTAGAGTCCAATCAGACACCCGCCGATGACTCGCAAATGATG
TCGGCTGGAACTGCCTCTCCTGAGGAACTTACTACCAATCTTGACTTTCTTAGAACGCAAGCGGACAGTTGGTTA
GCAGTCTTATTCAATGTCTTCGGCAGTGTCATTCCCGAATCCAGGAGCACGGTAGCCGACGTAATAAAGACCTGG
GCATCCATTGCCGATGAACAGGTCATTACGGGAGCTTACACAAAGGTCATCGCCCTTTTCCGCGCCAATCTTGCT
TCCGCACAAAATGCGCCCTCAACAGCAAACTCAAGCTCTGAGGCTGGGAGCGCAACCGCGATGACTCAAGATATT
CTTATACTGCTACTGCCCTACCTTTCGCAAGCCGATGCCCAGGCACTCTTCGAGTTATGTCTAAAATCAGAGGTT
CTCAGTGGCAAAGATAATGGAGTCCAGAAGCGCGGGTACAAAATTCTTGCCAAACTTCTTGAAGAAGACAGGGTC
AAGGTAGACGTTATAGCTGTCCTGAAGACTTTGGATGAGTTGTCAATAGGGCTAACGTCTGCCGCTAAGAAGGAC
CGATTTAACCTTTTGTCCGCAGCTATCCGCCACCTTCCTTCTTCCGCTCTGCATGTGATTCCCTCTATAATTCCT
GAAGCTGTTCTCGGTACGAAAGAACCCTCTGAGAAGGCACGTGGAGCCGCTTTTGAACTCATCTTGGCAATGGGT
CGAAAGATGAGTGTAGGAGGGATCGTGAGGAGGGATATGGTAGATGGAATGGATGAAGACGTCGACGGAGAAGCT
GCCGCTAACATCGAGGAATATATGACTATGATCGCCGGTGGTTTGGCGGGAGCAAGCCCACACATGATCAGCGCA
ACCGTCACCGCTATTTCACGCCTAGTTTTTGAGTTCAAAGACTCGATTTCTTCCAAAATGCATACTGAGATCCTG
CAAACGCTCCTTGTCTTCATAAACTCCGCAAATCGTGAAATCGTGAAATCAGTTCTTGGCTTTGTAAAGCTCGTT
ATTCATACGCTTCCCACTGAACTCGTGCGCCCTCATCTCAGCGAGCTTGTGCCTTCTTTGCTCAACTGGTCACAT
GACCACAACAATCACTTCAAGGTCAAAGTGAGGCACATATTCGAGAGACTCTTGAGGAGATTTAGCTGGGAAGAA
GTCTATTCTTGCGCAGGCAATGATGAGGCGGGTAAGGTTTTATTAAATGTCAAGAAAAGAAAGGATAGGGCAAAG
AGGAAACGTGCGGCCAGGGAGGAGGCAGGCGAAAGTGATGATGCCACACAAGATCGAAAACATGTTGCGGGAGAC
GCGTTTGAGGATGTCCTATATGGCAGCGAGAGCGAGCTGGAGGACAGTGATGACGAAGCCACCCCCACAACAAAA
AATAAAAATAAAGCTGGGAGGAAAAAGGGCGCAGGGCCAAGTGCTCATCTAAGATTAGATGATGATGAACCTATG
GATCTTCTGCAAGGCGCTGCAGGTCATGTTACCGGCGCAAAATCTAGTCGACGGCGTCAACCAGGACAAGATGCC
ACCCATTTTAAAACTGATGAGAAAACAGGAAAATTGATCATCGATAAAGAATCCGATTTCGGAAATGCTGGAGAA
GATGGCAACGGAGAAGACGAAGTTATTGTTGGAAACGCGTACAAGGAAAGTATGACATCGGTTGATGGTTTTACT
CGAGGGGCAGGTGGGCGAATCAAATTTAACAAAGACACGAAGAAGCGAAGAAGAGAGGAAATTGAAAGGGACGAC
GATGTAGAGATGGCGGATGCCGAAAATATCAGCGCTGGGAAGAAGAGCAAGAAAATAGGCAAGAGTGAACCGAGG
CTTGGACATGAATTTAAGGCCAAGAGGGCAGGGGGCGACGTCAAGAAGCACGGCCTAGATCCATACGCTTACCTT
TCCTTGTCAGAAGCTGCTAAGCGAAAGCAAGGTAACAAGCGAATCGGGATTGCTTCGAAGCGGTAA
Transcript >Agabi119p4|043140
ATGGAGGACACTCTGGCCAAGATCAGAGTCCACAAATCCTCTGCAGCACCAGCCCACAAAACCCCGGCCACATTG
CTCATAGCCGTAGAGTCAACCCTCCAGGAGCAGAACAAAGATCGTTCTCCCACCGCTTACTTTGCTGCGCTGCTT
ACCACCCTCGATGGCACCCTCCAACACAAGGATCTTAGTCTGGACGAAGGCGCCGTTCTACCTGCCGAATTGTAC
CTCATCTCTCTCGTTACTCCCTTCGTATCGAAACTGGTCATTCGTGCTCATCTCGGCACTTTACTCAACCTGACT
GCCCCACTCTTTCCTTTGGTGACATCTCACACCGCACCATTGCGCTCACAATTGTCAATATATCATGTTTTGTTC
CAATCGTTAGATCTATCACAGCTCGACACACCGACTCTTCCACAGACATTTGCTTCCATCTTGAATCTATGTCTC
GATTCACGACCAAAAATTCGCAGAAAAGCTGCCGACGTCGTCAAGGCTACACTCTGCAACCCACCGAACCCGCTC
ACTCGTCATCCATATGCGGGGAGAGCCGCTGAATTTGTAAAACTCACTTTGGGCGAGTTAGCCTCGGCTCCCTTT
GCTAAAGGCAAATCAAAAGAAACCGGTAATCGACCGGAGGATGCAATCCATGTACTTGCTTTTCTCAGACCTGTC
CTCACATATTTTCCACCCGCTGTTGTCCCAGAAATAACTACTCTCCTCCTCAGTCTCCCTCGCCTTGGTAACTCT
TACCTGACCCAAACATCTTACTCCATCTTATCCGATCTGTTCTCCCTTCCGGATGAGGATGAGGAATGCTCATTC
AGTAGTCAGCTTCCTGAAATGCTGCTCGCCATCCTCTCTTCCCCACCGGTCAAAACCGATGCCACAGTCTCACCC
GCATGGGTACAAGTTTTGGGTGATGCCATGCGGGTGTACAATGTTGTTGATACCGATGCATGTGGTAAAGAGTTG
AGTAGGGTTTGGAAGGCTGTGTGGAATTTCATTGACTCGAATGACCTTGAGACGCGAAAGAGTGCTGCGCACTCT
CTTAGCAAACTTAGCCAATGTTTCCCAACTTCTCTCATCTTGACCGCGGTTGCGGACCCCCAGGGGTCGTCGAAA
ATTACTAAAATCATTTCCCAGGTCACGCTAGCACTCGAAAATATTGCGTATGCTCGCTCGATCCCCGAAATACTA
GTCGTCATATCCAACCTCTTCATAGGACTGAAATACAGGCCATCAAGGGTGTCGCCCTCCGCTGCGGAGACATTG
ATGCTCCCTCTTATCTCCCAAGTAGGAGATCTTCGTACTCGGCGAGACTTCGAATTCAAAGAGGATGCGGACGCT
ACACTTAGAGTTGCGATGCAAGTCCTTGGTCCCGAGGTCTTACTACGCGTGTTACCCCTCAACCTCGAGCCGGAG
AAACGGAAAGCTGGAGGAGAACCACGTGCATACCTCCTTCCACTTCTAGCCCAGCCACATCCCTCTCCTCTCAGA
CATTTCATCTCTTATTTCGTTCCTCTCAGTGAAAGAATATTTGACCTCCAGCAAGCTGCTGAATCAGAGGGACGT
GCGTCGGAGGCCAAGGTCTGGAGCGTGCTCGTTGGTCAAATCTGGGCAGGGTTGGTGGGTTATTGTCACGCCCCC
ATTGATTTGAAAGAGGCGCTCAGCCCCACCTTTGCACAACTCCTCTCACAGCTACTCTATTCTCAAAGCGAGCTC
CGCCCAGCAATTCTCAGAGCGCTTACCATCATTGTAGAGTCCAATCAGACACCCGCCGATGACTCGCAAATGATG
TCGGCTGGAACTGCCTCTCCTGAGGAACTTACTACCAATCTTGACTTTCTTAGAACGCAAGCGGACAGTTGGTTA
GCAGTCTTATTCAATGTCTTCGGCAGTGTCATTCCCGAATCCAGGAGCACGGTAGCCGACGTAATAAAGACCTGG
GCATCCATTGCCGATGAACAGGTCATTACGGGAGCTTACACAAAGGTCATCGCCCTTTTCCGCGCCAATCTTGCT
TCCGCACAAAATGCGCCCTCAACAGCAAACTCAAGCTCTGAGGCTGGGAGCGCAACCGCGATGACTCAAGATATT
CTTATACTGCTACTGCCCTACCTTTCGCAAGCCGATGCCCAGGCACTCTTCGAGTTATGTCTAAAATCAGAGGTT
CTCAGTGGCAAAGATAATGGAGTCCAGAAGCGCGGGTACAAAATTCTTGCCAAACTTCTTGAAGAAGACAGGGTC
AAGGTAGACGTTATAGCTGTCCTGAAGACTTTGGATGAGTTGTCAATAGGGCTAACGTCTGCCGCTAAGAAGGAC
CGATTTAACCTTTTGTCCGCAGCTATCCGCCACCTTCCTTCTTCCGCTCTGCATGTGATTCCCTCTATAATTCCT
GAAGCTGTTCTCGGTACGAAAGAACCCTCTGAGAAGGCACGTGGAGCCGCTTTTGAACTCATCTTGGCAATGGGT
CGAAAGATGAGTGTAGGAGGGATCGTGAGGAGGGATATGGTAGATGGAATGGATGAAGACGTCGACGGAGAAGCT
GCCGCTAACATCGAGGAATATATGACTATGATCGCCGGTGGTTTGGCGGGAGCAAGCCCACACATGATCAGCGCA
ACCGTCACCGCTATTTCACGCCTAGTTTTTGAGTTCAAAGACTCGATTTCTTCCAAAATGCATACTGAGATCCTG
CAAACGCTCCTTGTCTTCATAAACTCCGCAAATCGTGAAATCGTGAAATCAGTTCTTGGCTTTGTAAAGCTCGTT
ATTCATACGCTTCCCACTGAACTCGTGCGCCCTCATCTCAGCGAGCTTGTGCCTTCTTTGCTCAACTGGTCACAT
GACCACAACAATCACTTCAAGGTCAAAGTGAGGCACATATTCGAGAGACTCTTGAGGAGATTTAGCTGGGAAGAA
GTCTATTCTTGCGCAGGCAATGATGAGGCGGGTAAGGTTTTATTAAATGTCAAGAAAAGAAAGGATAGGGCAAAG
AGGAAACGTGCGGCCAGGGAGGAGGCAGGCGAAAGTGATGATGCCACACAAGATCGAAAACATGTTGCGGGAGAC
GCGTTTGAGGATGTCCTATATGGCAGCGAGAGCGAGCTGGAGGACAGTGATGACGAAGCCACCCCCACAACAAAA
AATAAAAATAAAGCTGGGAGGAAAAAGGGCGCAGGGCCAAGTGCTCATCTAAGATTAGATGATGATGAACCTATG
GATCTTCTGCAAGGCGCTGCAGGTCATGTTACCGGCGCAAAATCTAGTCGACGGCGTCAACCAGGACAAGATGCC
ACCCATTTTAAAACTGATGAGAAAACAGGAAAATTGATCATCGATAAAGAATCCGATTTCGGAAATGCTGGAGAA
GATGGCAACGGAGAAGACGAAGTTATTGTTGGAAACGCGTACAAGGAAAGTATGACATCGGTTGATGGTTTTACT
CGAGGGGCAGGTGGGCGAATCAAATTTAACAAAGACACGAAGAAGCGAAGAAGAGAGGAAATTGAAAGGGACGAC
GATGTAGAGATGGCGGATGCCGAAAATATCAGCGCTGGGAAGAAGAGCAAGAAAATAGGCAAGAGTGAACCGAGG
CTTGGACATGAATTTAAGGCCAAGAGGGCAGGGGGCGACGTCAAGAAGCACGGCCTAGATCCATACGCTTACCTT
TCCTTGTCAGAAGCTGCTAAGCGAAAGCAAGGTAACAAGCGAATCGGGATTGCTTCGAAGCGGTAA
Gene >Agabi119p4|043140
ATGGAGGACACTCTGGCCAAGATCAGAGTCCACAAATCCTCTGCAGCACCAGCCCACAAAACCCCGGCCACATTG
CTCATAGCCGTAGAGTCAACCCTCCAGGAGCAGAACAAAGATCGTTCTCCCACCGCTTACTTTGCTGCGCTGCTT
ACCACCCTCGATGGCACCCTCCAACACAAGGATCTTAGTCTGGACGAAGGCGCCGTTCTACCTGCCGAATTGTAC
CTCATCTCTCTCGTTACTCCCTTCGTATCGAAACTGGTCATTCGTGCTCATCTCGGCACTTTACTCAACCTGACT
GCCCCACTCTTTCCTTTGGTGACATCTCACACCGCACCATTGCGCTCACAATTGTCAATATATCATGTTTTGTTC
CAATCGTTAGATCTATCACAGCTCGACACACCGACTCTTCCACAGACATTTGCTTCCATCTTGAATCTATGTCTC
GATTCACGACCAAAAATTCGCAGAAAAGCTGCCGACGTCGTCAAGGCTACACTCTGCAACCCACCGAACCCGCTC
ACTCGTCATCCATATGCGGGGAGAGCCGCTGAATTTGTAAAACTCACTTTGGGCGAGTTAGCCTCGGCTCCCTTT
GCTAAAGGCAAATCAAAAGAAACCGGTAATCGACCGGAGGATGCAATCCATGTACTTGCTTTTCTCAGACCTGTC
CTCACATATTTTCCACCCGCTGTATGTTGTATCTTTTTACTTGGAAAACCCTCTTTAATTGCGTCACCAGGTTGT
CCCAGAAATAACTACTCTCCTCCTCAGTCTCCCTCGCCTTGGTAACTCTTACCTGACCCAAACATCTTACTCCAT
CTTATCCGATCTGTTCTCCCTTCCGGATGAGGATGAGGAATGCTCATTCAGTAGTCAGCTTCCTGAAATGCTGCT
CGCCATCCTCTCTTCCCCACCGGTCAAAACCGATGCCACAGTCTCACCCGCATGGGTACAAGTTTTGGGTGATGC
CATGCGGGTGTACAATGTTGTTGATACCGATGCATGTGGTAAAGAGTTGAGTAGGGTTTGGAAGGCTGTGTGGAA
TTTCATTGACTCGAATGACCTTGAGACGCGAAAGAGTGCTGCGCACTCTCTTAGCAAACTTAGCCAATGTTTCCC
AACTTCTCTCATCTTGACCGCGGTTGCGGACCCCCAGGGGTCGTCGAAAATTACTAAAATCATTTCCCAGGTCAC
GCTAGCACTCGAAAATATTGCGTATGCTCGCTCGATCCCCGAAATACTAGTCGTCATATCCAACCTCTTCATAGG
ACTGAAATACAGGCCATCAAGGGTGTCGCCCTCCGCTGCGGAGACATTGATGCTCCCTCTTATCTCCCAAGTAGG
AGATCTTCGTACTCGGCGAGACTTCGAATTCAAAGAGGATGCGGACGCTACACTTAGAGTTGCGATGCAAGTCCT
TGGTCCCGAGGTCTTACTACGCGTGTTACCCCTCAACCTCGAGCCGGAGAAACGGTCAGTGTTCCTGTCCGTTCT
TTATTTTACAAAGCTAACTCTCTTCAGGAAAGCTGGAGGAGAACCACGTGCATACCTCCTTCCACTTCTAGCCCA
GCCACATCCCTCTCCTCTCAGACATTTCATCTCTTATTTCGTTCCTCTCAGTGAAAGAATATTTGACCTCCAGCA
AGCTGCTGAATCAGAGGGACGTGCGTCGGAGGCCAAGGTCTGGAGCGTGCTCGTTGGTCAAATCTGGGCAGGGTT
GGTGGGTTATTGTCACGCCCCCATTGATTTGAAAGAGGTAAATACGTTCATATATAGTTCGACCTCAACATCTGA
TTGATTCCGTGATCTTAGGCGCTCAGCCCCACCTTTGCACAACTCCTCTCACAGCTACTCTATTCTCAAAGCGAG
CTCCGCCCAGCAATTCTCAGAGCGCTTACCATCATTGTAGAGTCCAATCAGACACCCGCCGATGACTCGCAAATG
ATGTCGGCTGGAACTGCCTCTCCTGAGGAACTTACTACCAATCTTGACTTTCTTAGAACGCAAGCGGACAGTTGG
TTAGCAGTCTTATTCAATGTCTTCGGCAGTGTCATTCCCGAATCCAGGAGCACGGTAGCCGACGTAATAAAGACC
TGGGCATCCATTGCCGATGAACAGGTTAGTGTTTTGGATACGCTCCTGCCTTCGTGATAGATATAACTTTGCCCT
GCCATAGGTCATTACGGGAGCTTACACAAAGGTCATCGCCCTTTTCCGCGCCAATCTTGCTTCCGCACAAAATGC
GCCCTCAACAGCAAACTCAAGCTCTGAGGCTGGGAGCGCAACCGCGATGACTCAAGATATTCTTATACTGCTACT
GCCCTACCTTTCGCAAGCCGATGCCCAGGCACTCTTCGAGTTATGTCTAAAATCAGAGGTTCTCAGTGGCAAAGA
TAATGGAGTCCAGAAGCGCGGGTACAAAATTCTTGCCAAACTTCTTGAAGAAGACAGGGTCAAGGTAGACGTTAT
AGCTGTCCTGAAGACTTTGGATGAGTTGTCAATAGGGCTAACGTCTGCCGCTAAGAAGGTGCACTCGTTGACTTG
ATTCCTCTTCTGATAATACTGACCACATATGCAGGACCGATTTAACCTTTTGTCCGCAGCTATCCGCCACCTTCC
TTCTTCCGCTCTGCATGTGATTCCCTCTATAATTCCTGAAGCTGTTCTCGGTACGAAAGAACCCTCTGAGAAGGC
ACGTGGAGCCGCTTTTGAACTCATCTTGGCAATGGGTCGAAAGATGAGTGTAGGAGGGATCGTGAGGAGGGATAT
GGTAGATGGAATGGATGAAGACGTCGACGGAGAAGGTATGCACACGATTTCACTAACAGAGATGCGTCGCTCATA
TGTTTCTTCAAGCTGCCGCTAACATCGAGGAATATATGACTATGATCGCCGGTGGTTTGGCGGGAGCAAGCCCAC
ACATGATCAGCGCAACCGTCACCGCTATTTCACGCCTAGTTTTTGAGTTCAAAGGTACGTGTAAGACTACGGGTA
TATCAACCTTGCTCATATAACGAATTACAGACTCGATTTCTTCCAAAATGCATACTGAGATCCTGCAAACGCTCC
TTGTCTTCATAAACTCCGCAAATCGTGAAATCGTGAAATCAGTTCTTGGCTTTGTAAAGCTCGTTATTCATACGC
TTCCCACTGAACTCGTGCGCCCTCATCTCAGCGAGCTTGTGCCTTCTTTGCTCAACTGGTCACATGACCACAACA
ATCACTTCAAGGTCAAAGTGAGGCACATATTCGAGAGACTCTTGAGGAGATTTAGCTGGGAAGAAGTCTATTCTT
GCGCAGGCAATGATGAGGCGGGTAAGGTTTTATTAAATGTCAAGAAAAGAAAGGATAGGGCAAAGAGGAAACGTG
CGGCCAGGGAGGAGGCAGGCGAAAGTGATGATGCCGTAAGAAACAATCTTTTGCGATGCTTAATTTCTGTTCACT
GACTATGATATCAGACACAAGATCGAAAACATGTTGCGGGAGACGCGTTTGAGGATGTCCTATATGGCAGCGAGA
GCGAGCTGGAGGACAGTGATGACGAAGCCACCCCCACAACAAAAAATAAAAATAAAGCTGGGAGGAAAAAGGGCG
CAGGGCCAAGTGCTCATCTAAGATTAGATGATGATGAACCTATGGATCTTCTGCAAGGCGCTGCAGGTCATGTTA
CCGGTGAGTTTACTCTGAAACAGTTCGATTACGATCCCGCTCAAAATCCCTTAGGCGCAAAATCTAGTCGACGGC
GTCAACCAGGACAAGATGCCACCCATTTTAAAACTGATGAGAAAACAGGAAAATTGATCATCGATAAAGAATCCG
ATTTCGGAAATGCTGGAGAAGATGGCAACGGAGAAGACGAAGTTATTGTTGGAAACGCGTACAAGGAAAGTATGA
CATCGGTTGATGGTTTTACTCGAGGGGCAGGTGGGCGAATCAAATTTAACAAAGACACGAAGAAGCGAAGAAGAG
AGGAAATTGAAAGGGACGACGATGTAGAGATGGCGGATGCCGAAAATATCAGCGCTGGGAAGAAGAGCAAGAAAA
TAGGCAAGAGTGAACCGAGGCTTGGACATGAATTTAAGGCCAAGGTATGTCAGTTCCCATTGTCGACAAAAATAC
GCCCTGACAAATTTGGATTTGCTGCAGAGGGCAGGGGGCGACGTCAAGAAGCACGGCCTAGATCCATACGCTTAC
CTTTCCTTGTCAGAAGCTGCTAAGCGAAAGCAAGGTAACAAGCGAATCGGGATTGCTTCGAAGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail