Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|042970
Gene name
Locationscaffold_02:989168..990395
Strand-
Gene length (bp)1227
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01464 SLT Transglycosylase SLT domain 2.4E-12 174 262

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O31976|YOMI_BACSU SPBc2 prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) GN=yomI PE=3 SV=2 150 262 4.0E-07
sp|O64046|TMP_BPSPB Probable tape measure protein OS=Bacillus phage SPbeta GN=yomI PE=3 SV=1 150 262 4.0E-07
sp|O31608|YJBJ_BACSU Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) GN=yjbJ PE=3 SV=1 180 261 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|042970
MRLPAALLTVFLTLALANASNPRDHSLGARHSRIASRMSPLEKKAPQKRCVRRDKGSKAKVTSTAKKEHTSVKAS
PSEATFSPPSKDDGKPSGNASSGGKILVASGKCGGSNAVAKTTKDNGPNGSIGFLNCGVDGSGWNPPPVQIDDVI
VKSLSEAVQSPSSPFHACKSYVPLFNQYGDKYGIPAIFLASFAMQESSCNPNTVGGGGEQGLMQITKDKCDGAPG
GDCKDPDFNIRTGAKFFADTLKSAGGNVLKAVAFYNGWYEGLTIDKATAARHSSCCRCQQNLDYLHQFFNGWCQN
IDAYDRKLGKYFNLDTCPT*
Coding >Agabi119p4|042970
ATGAGGCTTCCAGCGGCCCTTCTCACTGTCTTCTTGACGCTCGCCCTTGCCAATGCCAGCAATCCTCGCGATCAC
TCCTTAGGTGCTCGTCACTCCCGTATTGCCTCCAGGATGTCTCCCCTCGAGAAAAAAGCTCCTCAGAAACGATGC
GTTCGACGTGATAAGGGCTCGAAGGCGAAAGTCACTTCCACCGCAAAAAAAGAACACACTTCAGTTAAAGCAAGC
CCCAGCGAGGCGACTTTCAGCCCTCCTAGCAAGGACGATGGAAAGCCCTCTGGAAATGCTTCCAGCGGTGGTAAA
ATACTCGTCGCTTCAGGCAAGTGTGGCGGTAGCAATGCAGTTGCTAAGACTACTAAGGACAATGGTCCTAACGGC
AGCATTGGTTTCTTGAATTGTGGTGTTGATGGGTCGGGGTGGAATCCTCCACCTGTTCAGATTGACGATGTCATC
GTCAAGAGTTTATCCGAGGCCGTTCAGTCGCCCAGTTCTCCATTTCACGCCTGCAAGTCTTATGTCCCGCTATTC
AATCAGTATGGGGACAAGTACGGAATTCCAGCCATCTTCTTGGCTTCGTTTGCCATGCAGGAGAGCTCATGCAAT
CCCAACACTGTTGGTGGCGGTGGTGAGCAAGGTCTCATGCAGATTACCAAGGACAAGTGCGATGGCGCACCTGGT
GGTGACTGCAAAGATCCCGACTTTAATATCCGTACTGGTGCTAAATTTTTTGCCGATACTTTGAAGAGTGCAGGA
GGGAATGTTTTGAAAGCCGTTGCTTTCTACAATGGCTGGTATGAAGGCTTGACTATCGACAAAGCAACTGCTGCC
CGCCACTCTAGCTGCTGTCGCTGCCAACAGAACTTGGATTACCTTCACCAGTTTTTCAATGGTTGGTGCCAGAAT
ATTGATGCTTATGACCGAAAGCTAGGAAAGTATTTCAATCTTGACACTTGCCCGACCTAA
Transcript >Agabi119p4|042970
ATGAGGCTTCCAGCGGCCCTTCTCACTGTCTTCTTGACGCTCGCCCTTGCCAATGCCAGCAATCCTCGCGATCAC
TCCTTAGGTGCTCGTCACTCCCGTATTGCCTCCAGGATGTCTCCCCTCGAGAAAAAAGCTCCTCAGAAACGATGC
GTTCGACGTGATAAGGGCTCGAAGGCGAAAGTCACTTCCACCGCAAAAAAAGAACACACTTCAGTTAAAGCAAGC
CCCAGCGAGGCGACTTTCAGCCCTCCTAGCAAGGACGATGGAAAGCCCTCTGGAAATGCTTCCAGCGGTGGTAAA
ATACTCGTCGCTTCAGGCAAGTGTGGCGGTAGCAATGCAGTTGCTAAGACTACTAAGGACAATGGTCCTAACGGC
AGCATTGGTTTCTTGAATTGTGGTGTTGATGGGTCGGGGTGGAATCCTCCACCTGTTCAGATTGACGATGTCATC
GTCAAGAGTTTATCCGAGGCCGTTCAGTCGCCCAGTTCTCCATTTCACGCCTGCAAGTCTTATGTCCCGCTATTC
AATCAGTATGGGGACAAGTACGGAATTCCAGCCATCTTCTTGGCTTCGTTTGCCATGCAGGAGAGCTCATGCAAT
CCCAACACTGTTGGTGGCGGTGGTGAGCAAGGTCTCATGCAGATTACCAAGGACAAGTGCGATGGCGCACCTGGT
GGTGACTGCAAAGATCCCGACTTTAATATCCGTACTGGTGCTAAATTTTTTGCCGATACTTTGAAGAGTGCAGGA
GGGAATGTTTTGAAAGCCGTTGCTTTCTACAATGGCTGGTATGAAGGCTTGACTATCGACAAAGCAACTGCTGCC
CGCCACTCTAGCTGCTGTCGCTGCCAACAGAACTTGGATTACCTTCACCAGTTTTTCAATGGTTGGTGCCAGAAT
ATTGATGCTTATGACCGAAAGCTAGGAAAGTATTTCAATCTTGACACTTGCCCGACCTAA
Gene >Agabi119p4|042970
ATGAGGCTTCCAGCGGCCCTTCTCACTGTCTTCTTGACGCTCGCCCTTGCCAATGCCAGCAATCCTCGCGATCAC
TCCTTAGGTGCTCGTCACTCCCGTATTGCCTCCAGGATGTCTCCCCTCGAGAAAAAAGCTCCTCAGAAACGATGC
GTTCGACGTGATAAGGTGGATAACAACATTTCATAGTTCCTGCTTTGGCTTCTGACAAGATTTTGAAGGGCTCGA
AGGCGAAAGTCACTTCCACCGCAAAAAAAGAACACACTTCAGTTAAAGCAAGCCCCAGCGAGGCGACTTTCAGCC
CTCCTAGCAAGGACGATGGAAAGCCCTCTGGAAATGCTTCCAGCGGTGGTAAAATACTCGTCGCTTCAGGCAAGT
GTGGCGGTAGCAATGCAGTTGGTCAGCTTGTCCTTTACTCCCACCACTATCACCCTGAACCATGCTCTAGCTAAG
ACTACTAAGGACAATGGTCCTAACGGCAGCATTGGTTTCTTGAATTGTGGTGTTGATGGGTCGGGGTGGAATCCT
CCACCTGTTCAGATTGACGATGTCATCGTCAAGAGTTTATCCGAGGCCGTTCAGTCGCCCAGTTCTCCATTTCAC
GCCTGCAAGTCTTATGTCCCGCTATTCAATCAGTATGGGGACAAGTACGGAATTCCAGCCATCTTCTTGGCTTCG
TTTGCCATGCAGGAGAGCTCATGCAATCCCAACACTGTTGGTGGCGGTGGTGAGCAAGGTCTCATGCAGATTACC
AAGGACAAGTGCGATGGCGCACCTGGTGGTGACTGCAAAGATCCCGTGAATAACTGTCGCTCTTTCCCGCTCTTT
TCATACTCAATGATTCTGTTCTATGCCAGGACTTTAATATCCGTACTGGTGCTAAATTTTTTGCCGATACTTTGA
AGAGTGCAGGAGGGAATGTTTTGAAAGCCGTTGCTTTCTACAATGGCTGGTATGAAGGCTTGACTATCGTGCGTT
TATCAAGTCATTTGCACCCAACAGATAAATATTAATGTAACCGTAGGACAAAGCAACTGCTGCCCGCCACTCTAG
CTGCTGTCGCTGCCAACAGAACTTGGATTAGTGAGTCTTGCGTTATCTGGAGTAGGAAAAGGGCTAAAATATTAT
ACGCACAGCCTTCACCAGTTTTTCAATGGTTGGTGCCAGAATATTGATGCTTATGACCGAAAGCTAGGAAAGTAT
TTCAATCTTGACACTTGCCCGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail