Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|042930
Gene name
Locationscaffold_02:974416..978504
Strand-
Gene length (bp)4088
Transcript length (bp)3039
Coding sequence length (bp)3039
Protein length (aa) 1013

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04137 ERO1 Endoplasmic Reticulum Oxidoreductin 1 (ERO1) 6.0E-127 74 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEY9|ERO1_NEUCR Endoplasmic reticulum oxidoreductin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ero-1 PE=3 SV=1 64 463 2.0E-87
sp|Q75BB5|ERO1_ASHGO Endoplasmic reticulum oxidoreductin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERO1 PE=3 SV=2 62 425 2.0E-86
sp|Q7X9I4|ERO2_ARATH Endoplasmic reticulum oxidoreductin-2 OS=Arabidopsis thaliana GN=AERO2 PE=1 SV=1 44 423 1.0E-82
sp|Q8NIP5|ERO1_KLULA Endoplasmic reticulum oxidoreductin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERO1 PE=3 SV=1 62 425 2.0E-81
sp|Q9C7S7|ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana GN=AERO1 PE=1 SV=1 55 444 1.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEY9|ERO1_NEUCR Endoplasmic reticulum oxidoreductin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ero-1 PE=3 SV=1 64 463 2.0E-87
sp|Q75BB5|ERO1_ASHGO Endoplasmic reticulum oxidoreductin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERO1 PE=3 SV=2 62 425 2.0E-86
sp|Q7X9I4|ERO2_ARATH Endoplasmic reticulum oxidoreductin-2 OS=Arabidopsis thaliana GN=AERO2 PE=1 SV=1 44 423 1.0E-82
sp|Q8NIP5|ERO1_KLULA Endoplasmic reticulum oxidoreductin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERO1 PE=3 SV=1 62 425 2.0E-81
sp|Q9C7S7|ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana GN=AERO1 PE=1 SV=1 55 444 1.0E-79
sp|Q03103|ERO1_YEAST Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERO1 PE=1 SV=1 18 436 4.0E-79
sp|Q8R2E9|ERO1B_MOUSE ERO1-like protein beta OS=Mus musculus GN=Ero1b PE=1 SV=1 53 424 1.0E-75
sp|Q86YB8|ERO1B_HUMAN ERO1-like protein beta OS=Homo sapiens GN=ERO1B PE=1 SV=2 45 424 2.0E-75
sp|Q9Y7P1|ERO12_SCHPO ERO1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero12 PE=1 SV=2 42 437 7.0E-72
sp|Q9V3A6|ERO1L_DROME Ero1-like protein OS=Drosophila melanogaster GN=Ero1L PE=2 SV=2 53 424 5.0E-71
sp|Q6DD71|ERO1A_XENLA ERO1-like protein alpha OS=Xenopus laevis GN=ero1a PE=2 SV=1 48 425 2.0E-70
sp|Q8R4A1|ERO1A_RAT ERO1-like protein alpha OS=Rattus norvegicus GN=Ero1a PE=1 SV=1 48 424 7.0E-70
sp|A5PJN2|ERO1A_BOVIN ERO1-like protein alpha OS=Bos taurus GN=ERO1A PE=2 SV=1 48 424 2.0E-69
sp|O74401|ERO11_SCHPO ERO1-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero11 PE=1 SV=1 83 447 2.0E-69
sp|Q8R180|ERO1A_MOUSE ERO1-like protein alpha OS=Mus musculus GN=Ero1a PE=1 SV=2 48 424 6.0E-69
sp|Q96HE7|ERO1A_HUMAN ERO1-like protein alpha OS=Homo sapiens GN=ERO1A PE=1 SV=2 48 424 7.0E-69
sp|B6CVD7|ERO1A_PIG ERO1-like protein alpha OS=Sus scrofa GN=ERO1A PE=2 SV=1 48 424 1.0E-68
sp|B1H1F9|ERO1A_XENTR ERO1-like protein alpha OS=Xenopus tropicalis GN=ero1a PE=2 SV=1 48 424 1.0E-67
sp|Q7T3D1|ERO1A_DANRE ERO1-like protein alpha OS=Danio rerio GN=ero1a PE=2 SV=1 48 382 4.0E-64
sp|Q7YTU4|ERO1_CAEEL Endoplasmic reticulum oxidoreductin-1 OS=Caenorhabditis elegans GN=ero-1 PE=3 SV=2 65 426 4.0E-62
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0034975 protein folding in endoplasmic reticulum Yes
GO:0015035 protein-disulfide reductase activity Yes
GO:0016972 thiol oxidase activity Yes
GO:0005783 endoplasmic reticulum Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0005575 cellular_component No
GO:1901265 nucleoside phosphate binding No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043227 membrane-bounded organelle No
GO:0005488 binding No
GO:0015036 disulfide oxidoreductase activity No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043226 organelle No
GO:0009987 cellular process No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:0006457 protein folding No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|042930
MRLLLLSPFALLINVSVRAERSFLSDTFVRKDQVQHVMEYEPVKIPSCQNAVLTGPIETTLCDYETVESMNDNLL
SNLSDLVRMPFFRYFQVDLYRQCPFWVDHGSCANEGCAITTVDESDIPEKWRAAALSKVDPDSIDTRHELPGCYY
RDSDYCFLDDNTEGDYYDLQLVPERYTGYSGHDARRIWKSIYEENCFGLSESGLLSGKLPLVSAPDTEQCLEKKV
YYKLISGLHTSISTHICHEYLNQTTGEWGPNLNCFISRVAAYPERLQHLYFNTIVMLRAVARLEPYLAAFDFCSS
GKAEDDVETQDCLSKIVRIAKDAGKFDESALFRGENANVLKEEFKAHFRNVSRIMDCVGCDKCRLWGKIQTTGLA
TALKILFELDENALNPRTNRDFLHRAEMIALFNTLFRFSESIRAVDDFRREWKELDEAESRKLIKETERTTSARP
KPSPHVDEKYRTIPLLTMRLWFSSLFKACQKSTIGDAATGREAVLTPPPLLPVLPRAPSSFSCLANVSVSMIVAN
DDQHKQDSYNGPTVRPPEPAARRRRSFSPLPDYEASEAQYRKSLTVDRKRSWHQSKTWRTILFLLLTYTFLTIVV
GVPIIVTQLRNRQHDDGFPLTDPDLLANQFASSGPGITYTNDLPCNSWNETKLNLAPLLYTATLDMQLPLTGDIS
IRSNATLDETPATKLSGNLLVEYDPNLNSDSAFISVSLHTSTLALREATRVCYSYDGPDRGISIFFPNDMTDDDL
IDMDIRVVFPQSITPTIIPNFNVFLPMFTQNIQDLTKINFGSVNIDGSFRTINVTNIQAPCITVKNMIGDIMGVF
NASETLILDTLKGIVDASITLVKPIYRTTPTKFLLDTGDESINAKISLVSPASDNSLLSSPHFFGTINNFNAPVT
VTFTQPNSSPAIPVRVTIQNSLAATDVVMDQKFEGSFVAQTRLGRVSIDQSDGNSMINPFASDTPRTIVYKEDSA
PSRRSGWISGGKEPPNSQSRVEIYSSLGPIGLHFGPT*
Coding >Agabi119p4|042930
ATGAGACTCCTTCTCCTCTCCCCCTTCGCCTTACTCATCAACGTCTCAGTGAGGGCCGAGAGATCATTTCTGTCA
GATACCTTTGTTAGGAAGGATCAGGTCCAACATGTTATGGAATATGAACCAGTCAAAATCCCTTCTTGTCAAAAC
GCTGTTCTGACTGGTCCAATAGAGACCACTCTCTGCGACTATGAGACTGTAGAAAGCATGAACGACAATCTTCTC
AGCAATCTTTCGGACCTCGTCCGTATGCCCTTCTTTCGATATTTCCAGGTCGACCTGTACCGCCAATGTCCGTTC
TGGGTAGATCATGGTTCATGTGCCAATGAAGGCTGCGCTATAACTACCGTCGACGAGAGTGATATACCTGAAAAA
TGGAGGGCTGCGGCTTTAAGCAAAGTGGACCCTGATTCAATTGACACACGGCATGAATTACCAGGTTGCTACTAC
CGTGACTCGGATTACTGCTTTTTAGATGATAATACTGAGGGGGATTACTACGACCTCCAACTGGTTCCGGAAAGG
TACACCGGTTATTCCGGTCACGATGCGCGGCGGATATGGAAGTCCATCTATGAAGAGAACTGCTTCGGTTTATCC
GAATCTGGCTTGTTAAGTGGGAAATTACCGCTCGTATCAGCACCCGATACAGAGCAATGTCTTGAAAAGAAAGTG
TATTACAAGCTTATATCAGGTCTTCACACATCGATATCTACACACATTTGTCACGAGTATCTAAACCAGACGACG
GGCGAATGGGGACCAAATCTGAATTGTTTCATATCTCGCGTCGCAGCATATCCCGAGCGCCTGCAACACCTGTAT
TTCAATACTATCGTTATGTTGCGCGCAGTCGCTCGTCTCGAACCATACCTCGCGGCCTTTGACTTTTGCTCTTCC
GGAAAAGCCGAGGACGACGTTGAGACCCAGGATTGTCTATCCAAGATTGTTCGCATTGCCAAAGATGCTGGAAAG
TTTGACGAAAGTGCCTTATTCAGAGGTGAAAATGCGAATGTTCTCAAGGAAGAGTTCAAAGCCCACTTCAGAAAT
GTATCCCGTATCATGGACTGTGTAGGCTGCGATAAGTGCAGACTTTGGGGCAAGATTCAGACAACGGGACTCGCC
ACCGCGCTCAAGATTTTATTTGAACTCGACGAAAACGCATTAAACCCTAGGACTAATCGAGACTTTCTTCATCGA
GCCGAAATGATCGCATTATTCAATACTCTCTTTCGGTTTAGCGAGAGTATTCGTGCCGTTGATGACTTCCGTCGT
GAATGGAAGGAGTTAGACGAGGCAGAATCCCGGAAGTTGATAAAAGAGACAGAGAGAACTACCAGCGCAAGACCG
AAACCGTCTCCCCATGTAGACGAGAAGTACCGGACGATCCCGCTGCTGACGATGAGACTCTGGTTCTCATCGCTG
TTCAAGGCATGTCAGAAAAGCACGATCGGAGATGCAGCAACCGGGCGCGAGGCCGTCTTGACTCCGCCACCTCTC
CTTCCCGTTCTCCCGCGGGCTCCCTCTTCGTTCTCCTGTCTTGCCAATGTGTCGGTGAGCATGATCGTAGCCAAT
GATGATCAGCACAAGCAAGATTCCTACAATGGTCCCACCGTTCGTCCCCCGGAGCCCGCTGCCCGACGAAGACGT
TCCTTCTCTCCTCTCCCCGATTACGAGGCTTCTGAGGCACAATACCGGAAGAGCCTTACTGTGGATCGTAAAAGG
TCATGGCATCAGTCAAAGACGTGGAGAACCATTCTCTTCCTCCTGTTGACGTACACTTTCTTAACGATCGTCGTT
GGCGTACCGATCATCGTAACACAGCTGAGGAACCGACAACATGACGACGGTTTTCCACTGACCGACCCAGATCTA
CTGGCGAACCAATTTGCATCGTCTGGCCCGGGTATAACCTATACCAACGACTTGCCTTGTAACAGTTGGAATGAA
ACAAAATTGAACCTCGCTCCTCTATTATATACTGCGACTCTTGATATGCAGTTGCCATTGACGGGTGACATCTCC
ATTCGTTCCAATGCCACCCTCGATGAAACACCTGCCACCAAACTTTCTGGAAATCTTCTTGTGGAATATGACCCC
AATCTCAACAGTGACAGTGCTTTCATTTCTGTGAGCCTACACACGTCTACCCTAGCTCTCCGCGAAGCAACTCGT
GTTTGTTATTCTTACGATGGTCCTGATCGTGGAATCTCCATATTTTTCCCCAACGACATGACGGATGACGACCTG
ATAGACATGGACATCCGAGTCGTTTTCCCACAATCTATCACACCCACTATCATTCCCAATTTCAATGTATTCCTG
CCAATGTTCACGCAGAACATTCAAGATTTGACAAAAATTAACTTTGGCTCAGTCAATATTGACGGGTCCTTCCGG
ACGATCAACGTGACGAATATACAGGCTCCTTGTATAACTGTCAAGAACATGATAGGAGACATAATGGGAGTGTTC
AATGCCTCCGAAACTCTCATTCTGGACACTCTGAAAGGGATAGTCGATGCATCAATAACCCTCGTCAAACCAATA
TACCGCACCACTCCAACAAAATTCCTATTGGATACTGGTGATGAATCTATCAATGCTAAAATCTCACTCGTTTCA
CCTGCTTCCGACAACTCTTTGTTATCCTCCCCGCATTTCTTCGGCACAATAAACAACTTCAATGCGCCTGTCACT
GTGACATTCACCCAACCCAACTCCTCACCTGCCATACCTGTGCGCGTCACAATACAGAATAGCTTGGCAGCGACA
GACGTGGTTATGGACCAGAAGTTCGAAGGTTCCTTTGTTGCGCAGACAAGGCTCGGTCGTGTATCAATTGACCAG
AGCGACGGAAATTCGATGATAAATCCTTTTGCATCAGATACACCACGGACAATCGTTTACAAGGAAGATTCGGCA
CCTTCAAGAAGAAGTGGCTGGATCAGTGGGGGGAAAGAGCCTCCAAACAGTCAGAGTCGTGTAGAAATCTACTCG
TCTCTAGGACCTATTGGCTTACACTTTGGACCGACATGA
Transcript >Agabi119p4|042930
ATGAGACTCCTTCTCCTCTCCCCCTTCGCCTTACTCATCAACGTCTCAGTGAGGGCCGAGAGATCATTTCTGTCA
GATACCTTTGTTAGGAAGGATCAGGTCCAACATGTTATGGAATATGAACCAGTCAAAATCCCTTCTTGTCAAAAC
GCTGTTCTGACTGGTCCAATAGAGACCACTCTCTGCGACTATGAGACTGTAGAAAGCATGAACGACAATCTTCTC
AGCAATCTTTCGGACCTCGTCCGTATGCCCTTCTTTCGATATTTCCAGGTCGACCTGTACCGCCAATGTCCGTTC
TGGGTAGATCATGGTTCATGTGCCAATGAAGGCTGCGCTATAACTACCGTCGACGAGAGTGATATACCTGAAAAA
TGGAGGGCTGCGGCTTTAAGCAAAGTGGACCCTGATTCAATTGACACACGGCATGAATTACCAGGTTGCTACTAC
CGTGACTCGGATTACTGCTTTTTAGATGATAATACTGAGGGGGATTACTACGACCTCCAACTGGTTCCGGAAAGG
TACACCGGTTATTCCGGTCACGATGCGCGGCGGATATGGAAGTCCATCTATGAAGAGAACTGCTTCGGTTTATCC
GAATCTGGCTTGTTAAGTGGGAAATTACCGCTCGTATCAGCACCCGATACAGAGCAATGTCTTGAAAAGAAAGTG
TATTACAAGCTTATATCAGGTCTTCACACATCGATATCTACACACATTTGTCACGAGTATCTAAACCAGACGACG
GGCGAATGGGGACCAAATCTGAATTGTTTCATATCTCGCGTCGCAGCATATCCCGAGCGCCTGCAACACCTGTAT
TTCAATACTATCGTTATGTTGCGCGCAGTCGCTCGTCTCGAACCATACCTCGCGGCCTTTGACTTTTGCTCTTCC
GGAAAAGCCGAGGACGACGTTGAGACCCAGGATTGTCTATCCAAGATTGTTCGCATTGCCAAAGATGCTGGAAAG
TTTGACGAAAGTGCCTTATTCAGAGGTGAAAATGCGAATGTTCTCAAGGAAGAGTTCAAAGCCCACTTCAGAAAT
GTATCCCGTATCATGGACTGTGTAGGCTGCGATAAGTGCAGACTTTGGGGCAAGATTCAGACAACGGGACTCGCC
ACCGCGCTCAAGATTTTATTTGAACTCGACGAAAACGCATTAAACCCTAGGACTAATCGAGACTTTCTTCATCGA
GCCGAAATGATCGCATTATTCAATACTCTCTTTCGGTTTAGCGAGAGTATTCGTGCCGTTGATGACTTCCGTCGT
GAATGGAAGGAGTTAGACGAGGCAGAATCCCGGAAGTTGATAAAAGAGACAGAGAGAACTACCAGCGCAAGACCG
AAACCGTCTCCCCATGTAGACGAGAAGTACCGGACGATCCCGCTGCTGACGATGAGACTCTGGTTCTCATCGCTG
TTCAAGGCATGTCAGAAAAGCACGATCGGAGATGCAGCAACCGGGCGCGAGGCCGTCTTGACTCCGCCACCTCTC
CTTCCCGTTCTCCCGCGGGCTCCCTCTTCGTTCTCCTGTCTTGCCAATGTGTCGGTGAGCATGATCGTAGCCAAT
GATGATCAGCACAAGCAAGATTCCTACAATGGTCCCACCGTTCGTCCCCCGGAGCCCGCTGCCCGACGAAGACGT
TCCTTCTCTCCTCTCCCCGATTACGAGGCTTCTGAGGCACAATACCGGAAGAGCCTTACTGTGGATCGTAAAAGG
TCATGGCATCAGTCAAAGACGTGGAGAACCATTCTCTTCCTCCTGTTGACGTACACTTTCTTAACGATCGTCGTT
GGCGTACCGATCATCGTAACACAGCTGAGGAACCGACAACATGACGACGGTTTTCCACTGACCGACCCAGATCTA
CTGGCGAACCAATTTGCATCGTCTGGCCCGGGTATAACCTATACCAACGACTTGCCTTGTAACAGTTGGAATGAA
ACAAAATTGAACCTCGCTCCTCTATTATATACTGCGACTCTTGATATGCAGTTGCCATTGACGGGTGACATCTCC
ATTCGTTCCAATGCCACCCTCGATGAAACACCTGCCACCAAACTTTCTGGAAATCTTCTTGTGGAATATGACCCC
AATCTCAACAGTGACAGTGCTTTCATTTCTGTGAGCCTACACACGTCTACCCTAGCTCTCCGCGAAGCAACTCGT
GTTTGTTATTCTTACGATGGTCCTGATCGTGGAATCTCCATATTTTTCCCCAACGACATGACGGATGACGACCTG
ATAGACATGGACATCCGAGTCGTTTTCCCACAATCTATCACACCCACTATCATTCCCAATTTCAATGTATTCCTG
CCAATGTTCACGCAGAACATTCAAGATTTGACAAAAATTAACTTTGGCTCAGTCAATATTGACGGGTCCTTCCGG
ACGATCAACGTGACGAATATACAGGCTCCTTGTATAACTGTCAAGAACATGATAGGAGACATAATGGGAGTGTTC
AATGCCTCCGAAACTCTCATTCTGGACACTCTGAAAGGGATAGTCGATGCATCAATAACCCTCGTCAAACCAATA
TACCGCACCACTCCAACAAAATTCCTATTGGATACTGGTGATGAATCTATCAATGCTAAAATCTCACTCGTTTCA
CCTGCTTCCGACAACTCTTTGTTATCCTCCCCGCATTTCTTCGGCACAATAAACAACTTCAATGCGCCTGTCACT
GTGACATTCACCCAACCCAACTCCTCACCTGCCATACCTGTGCGCGTCACAATACAGAATAGCTTGGCAGCGACA
GACGTGGTTATGGACCAGAAGTTCGAAGGTTCCTTTGTTGCGCAGACAAGGCTCGGTCGTGTATCAATTGACCAG
AGCGACGGAAATTCGATGATAAATCCTTTTGCATCAGATACACCACGGACAATCGTTTACAAGGAAGATTCGGCA
CCTTCAAGAAGAAGTGGCTGGATCAGTGGGGGGAAAGAGCCTCCAAACAGTCAGAGTCGTGTAGAAATCTACTCG
TCTCTAGGACCTATTGGCTTACACTTTGGACCGACATGA
Gene >Agabi119p4|042930
ATGAGACTCCTTCTCCTCTCCCCCTTCGCCTTACTCATCAACGTCTCAGTGAGGGCCGAGAGATCATTTCTGTCA
GATACCTTTGTTAGGAAGGATCAGGTCCAACATGTTATGGAATATGAACCAGTCAAAATCCCTTCTTGTCAAAAC
GCTGTTGTGAGTTATTCAACCAATCTACGGTCCCCGCACTGCTCACACGCTATTTCTTAGCTGACTGGTCCAATA
GAGACCACTCTCTGCGACTATGAGACTGTAGAAAGCATGAACGACAATCTTCTCAGCAATCTTTCGGACCTCGTC
CGTATGCCCTTCTTTCGATATTTCCAGGTGGGATCCATCCTTGTGACCCTTCTCTCTATGGCTAATAAATCCCAA
GGTCGACCTGTACCGCCAATGTCCGTTCTGGGTAGATCATGGTTCATGTGCCAATGAAGGCTGCGCTATAACTAC
CGTCGACGAGGTCAGCTCGCGCCACTTCGGCAACCCAAACACTACTAAGCGCTTATCAAATTAGAGTGATATACC
TGAAAAATGGAGGGCTGCGGCTTTAAGCAAAGTGGACCCTGATTCAATTGACACAGTAGGTTTAAATCATCATCC
GTGAAAATGATATGATTGATCCCGCCACGCTTACCTCTAGCGGCATGAATTACCAGGTTGCTACTACCGTGACTC
GGATTACTGCTTTTTAGATGATAATACTGGTACGTGCTCCCACATCTCGTTCAGGTTACCTCTCTAATGAGTCAC
ATAGAGGGGGATTACTACGACCTCCAACTGGTTCCGGAAAGGTACACCGGTTATTCCGGTCACGATGCGCGGCGG
ATATGGAAGTCCATCTATGAAGAGAACTGCTTCGGTTTATCCGAATCTGGCTTGTTAAGTGGGAAATTACCGCTC
GTATCAGCACCCGATACAGAGCAATGTCTTGAAAAGAAAGTGTATTACAAGCTTATATCAGGTATGCTTTCGTTT
CAGTTGGCGGGTGATATCATAGCTCAATTCGCACAAGGTCTTCACACATCGATATCTACACACATTTGTCACGAG
TATCTAAACCAGACGACGGGCGAATGGGTAAGTCCGAATATTTCCAGTCGGATGATCCGTTTGACCATTGACTCA
GGGACCAAATCTGAATTGTTTCATATCTCGCGTCGCAGCATATCCCGAGCGCCTGCAACACCTGTATTTCAATAC
TATCGTTATGTTGCGCGCAGTCGCTCGTCTCGAACCATACCTCGCGGCCTTTGACTTTTGCTCTTCCGGAAAAGC
CGAGGACGACGTTGAGACCCAGGATTGTCTATCCAAGATTGTTCGCATTGCCAAAGATGCTGGAAAGTTTGACGA
AAGTGCCTTATTCAGAGGTGAAAATGCGAATGTTGGTCCCTTCTTCTTCGATTACAGATCAAAACAATGACGTTA
GGAGCCAGGTTCTCAAGGAAGAGTTCAAAGCCCACTTCAGAAATGTATCCCGTATCATGGACTGTGTAGGCTGCG
ATAAGTGCAGACTTTGGGGCAAGATTCAGACAACGGGACTCGCCACCGCGCTCAAGATTTTATTTGAACTCGACG
AAAACGCATTAAAGTGAGTGGCGGCTTCGAACTTGCCATATATGTTTTGGTTTGTGACAAGTTTTTAGCCCTAGG
ACTAATCGAGACTTTCTTCATCGAGCCGAAATGATCGCATTATTCAATACTCTCTTTCGGTTTAGCGAGAGTATT
CGTGCCGTTGATGACTTCCGTCGTGAATGGAAGGAGTTAGACGAGGCAGAATCCCGGAAGTTGATAAAAGAGACA
GAGAGAACTACCAGCGCAAGAGTAGGTCGAAACCATGACGAATTCTAGTGGCATTCAGACATCTAACGGGACTAT
AGCCGAAACCGTCTCCCCATGTAGACGAGAAGTACCGGACGATCCCGCTGCTGACGATGAGACTCTGGTTCTCAT
CGCTGTTCAAGGCATGTCAGAAAAGCACGATCGGGTGTGCGGGAGCGGTATGGGACACGTTGCGGAGTTGGATGG
GACAGACGTTCACTCTGTTCGAGAAGTTCAATCTGCACAAAGAACGCGGGCCTGGAGCCAATTATGGGGAACTCT
GAGAGAGTATGGACAGTAGGGACACGTATGATAGATTAATTGTATTTTTGGACGGGAAAGTGCGAGGATGACTAA
GTGTTACGCTGGTCAGAGATGCAGCAACCGGGCGCGAGGCCGTCTTGACTCCGCCACCTCTCCTTCCCGTTCTCC
CGCGGGCTCCCTCTTCGTTCTCCTGTCTTGCCAATGTGTCGGTGAGCATGATCGTAGCCAATGATGATCAGCACA
AGCAAGATTCCTACAATGGTCCCACCGTTCGTCCCCCGGAGCCCGCTGCCCGACGAAGACGTTCCTTCTCTCCTC
TCCCCGATTACGAGGCTTCTGAGGCACAATACCGGAAGAGCCTTACTGTGGATCGTAAAAGGTCATGGCATCAGT
CAAAGACGTGGAGAACCATTCTCTTCCTCCTGTTGACGTACACTTTCTTAACGATCGTCGTTGGCGTACCGATCA
TCGTAACAGTGAGTCAACCGCTTCCCTCCAAAAGGCAAACAATGGCTCATGTGTAACCCAGCAGCTGAGGAACCG
ACAACATGACGACGGTTTTCCACTGACCGACCCAGATCTACTGGCGAACCAATTTGCATCGTCTGGCCCGGGTAT
AACCTATACCAACGACTTGCCTTGTAACAGTTGGAATGAAACAAAATTGAACCTCGCTCCTCTATTATATACTGC
GACGTACGTGTCCATCATCAATCCTATCTGCGTCGTGCTAAGAGTGTTGTCTAGTCTTGATATGCAGTTGCCATT
GACGGGTGACATCTCCATTCGTTCCAATGCCACCCTCGATGAAACACCTGCCACCAAACTTTCTGGAAATCTTCT
TGTGGAATATGACCCCAATCTCAACAGTGACAGTGCTTTCATTTCTGTGAGCCTACACACGTCTACCCTAGCTCT
CCGCGAAGCAACTCGTGTTTGTTATTCTTACGATGGTCCTGATCGTGGAATCTCCATATTTGTGCGATTATCTCT
ATTGTCCTGAAAGAATCAACTCATAATATGTATTGTAGTTCCCCAACGACATGACGGATGACGACCTGATAGACA
TGGACATCCGAGTCGTTTTCCCACAATCTATCACACCCACTATCATTCCCAATTTCAATGTATTCCTGCCAATGT
TCACGCAGAACATTCAAGATTTGACAAAAATTAACTTTGGCTCAGTCAATATTGACGGGTCCTTCCGGACGATCA
ACGTGACGGTATGCCCCTCCGTGTTGCATGTTCGACGTACATTAACTCTGGGTGTAGAATATACAGGCTCCTTGT
ATAACTGTCAAGAACATGATAGGAGACATAATGGGAGTGTTCAATGCCTCCGAAACTCTCATTCTGGACACTCTG
AAAGGGTAATCATAAATCTGACGACTATGAAGAAAATGACTTATCACCCCAATTTATCCAGGATAGTCGATGCAT
CAATAACCCTCGTCAAACCAATATACCGCACCACTCCAACAAAATTCCTATTGGATACTGGTGATGAGTAAGTGA
AGTCATTTTCGTTCTTGATTCTGTTCTCATTCACGTGAATCAGATCTATCAATGCTAAAATCTCACTCGTTTCAC
CTGCTTCCGACAACTCTTTGTTATCCTCCCCGCATTTCTTCGGCACAATAAACAACTTCAATGCGCCTGTCACTG
TGACATTCACCCAACCCAACTCCTCACCTGCCATACCTGTGCGCGTCACAATACAGAATAGCTTGGCAGCGACAG
ACGTGGTTATGGACCAGAAGTTCGAAGGTTCCTTTGTTGCGCAGACAAGGCTCGGTCGTGTATCAATTGACCAGA
GCGACGGAAATTCGATGATAAATCCTTTTGCATCAGATACACCACGGACAATCGTTTACAAGGAAGATTCGGCAC
CTTCAAGAAGAAGTGGCTGGATCAGTGGGGGGAAAGAGCCTCCAAACAGTCAGAGTCGTGTAGAAATCTACTCGT
CTCTAGGACCTATTGGCTTACACTTTGGACCGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail