Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|042830
Gene name
Locationscaffold_02:955157..957794
Strand-
Gene length (bp)2637
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10191 COG7 Golgi complex component 7 (COG7) 6.9E-43 40 359
PF10191 COG7 Golgi complex component 7 (COG7) 8.5E-30 407 735

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2VDR8|COG7_BOVIN Conserved oligomeric Golgi complex subunit 7 OS=Bos taurus GN=COG7 PE=2 SV=1 40 854 2.0E-40
sp|Q3UM29|COG7_MOUSE Conserved oligomeric Golgi complex subunit 7 OS=Mus musculus GN=Cog7 PE=1 SV=1 17 835 1.0E-36
sp|Q3T1G7|COG7_RAT Conserved oligomeric Golgi complex subunit 7 OS=Rattus norvegicus GN=Cog7 PE=2 SV=1 17 835 2.0E-35
sp|P83436|COG7_HUMAN Conserved oligomeric Golgi complex subunit 7 OS=Homo sapiens GN=COG7 PE=1 SV=1 40 835 1.0E-34
sp|Q54LC8|COG7_DICDI Conserved oligomeric Golgi complex subunit 7 OS=Dictyostelium discoideum GN=cog7 PE=3 SV=1 53 367 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2VDR8|COG7_BOVIN Conserved oligomeric Golgi complex subunit 7 OS=Bos taurus GN=COG7 PE=2 SV=1 40 854 2.0E-40
sp|Q3UM29|COG7_MOUSE Conserved oligomeric Golgi complex subunit 7 OS=Mus musculus GN=Cog7 PE=1 SV=1 17 835 1.0E-36
sp|Q3T1G7|COG7_RAT Conserved oligomeric Golgi complex subunit 7 OS=Rattus norvegicus GN=Cog7 PE=2 SV=1 17 835 2.0E-35
sp|P83436|COG7_HUMAN Conserved oligomeric Golgi complex subunit 7 OS=Homo sapiens GN=COG7 PE=1 SV=1 40 835 1.0E-34
sp|Q54LC8|COG7_DICDI Conserved oligomeric Golgi complex subunit 7 OS=Dictyostelium discoideum GN=cog7 PE=3 SV=1 53 367 4.0E-16
sp|Q9VAD6|COG7_DROME Conserved oligomeric Golgi complex subunit 7 OS=Drosophila melanogaster GN=Cog7 PE=2 SV=2 21 834 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0017119 Golgi transport complex Yes
GO:0006886 intracellular protein transport Yes
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0032991 protein-containing complex No
GO:0099023 vesicle tethering complex No
GO:0015031 protein transport No
GO:0071705 nitrogen compound transport No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0008104 protein localization No
GO:0006810 transport No
GO:0051649 establishment of localization in cell No
GO:0045184 establishment of protein localization No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|042830
MSTSTAEIVDSLEQCGEVISWINDTLIPSDDSDGLNIGVASLTKLDQQITQLLTTLDIASEDSSTRLEHIIDDVS
RGIPRLAYDLHFMKDGALALQSNLTAILHQARDTLPPSTDVVLRQLHELDLIKSRMESVREVLREAESWSTLEME
VTSLIAEKTYAKAAERLSDASKSMVVFQNTPEYDPRRNLMINLQNQLEASLSSALVLAINAQDVASCKEYFAIFS
IIQRESEFRNYYYAARRSSVITLWQTTRLAECGEVSEEETRDDRQTFTEFLRKFYDALSSILNIERAPICSIFPD
PRNTLSSFIASTLSALQPTYPQRLSSLAERKNDVVLTELISALRLTEDFAISVGKIMEKVEFAADAPMPRRSSIS
EKPTHARRRSTRMSISWRHGPNKSVSSSGIQQALSQASEVMEWEQELFQPFLDFQTDYGSLEKRFLEHSLAEITA
SDAKERVEDVDRPRLLRERAVDIFGLAEGSMGRCNALTHGYGAVGLIWALDNLFKSFMESWATELQTNRSKTVSI
DKSVVEDEDLADLDYTAHDWSNIQLCLHLLSSARTISERLAGFEMKLRNYLAQIASQFRMAKDDPVNFTIGPVRG
EGQLLEQSTLNSVELRTLLDTIENDSTHFRPGQTHPPHEPLLMNARRALFHFAQTCQNALQKTILSPLRQHLSSY
PSSMMWSTAGDPRKSETDLKVPTFSLPPSETMQKVAGGLLNLPRLFEVYADDDALSFALQTLPHLDFEMLKGLTE
SLVTETPVPSGGHMRRASVSFTSKTSVVDPEAVSSAWLLSLGHTFIGYVTQEILPAISSLSTAGAAQLASDLEYL
MNIVRALNVEHEGLEKWRMYVEMEEEDMRAKLEDNEDTADSILADIARLRGLE*
Coding >Agabi119p4|042830
ATGTCGACATCCACAGCCGAAATAGTTGACTCCCTCGAGCAGTGTGGTGAAGTTATCTCCTGGATCAACGACACC
CTCATACCCTCTGACGACTCAGATGGTCTCAATATCGGCGTCGCTAGCCTTACAAAGCTTGACCAACAAATCACT
CAACTCCTTACAACCCTAGACATCGCCTCGGAGGACTCATCAACCCGGTTAGAACATATTATTGACGATGTATCG
CGTGGAATTCCTCGGCTTGCTTATGACCTTCATTTTATGAAAGATGGGGCACTGGCATTGCAGAGTAACCTTACG
GCCATCCTCCATCAGGCACGCGATACACTGCCCCCCAGCACGGATGTTGTCCTCAGACAATTGCACGAGCTGGAT
CTCATCAAGAGCCGAATGGAATCAGTAAGGGAAGTTCTACGGGAAGCTGAGAGTTGGAGTACATTGGAGATGGAA
GTGACATCTCTCATCGCGGAGAAGACTTATGCCAAGGCGGCGGAGCGACTCTCAGATGCCAGCAAAAGCATGGTG
GTCTTCCAAAACACTCCTGAATACGACCCGAGGCGAAATCTTATGATAAACCTGCAAAATCAACTTGAAGCCTCC
TTGAGTTCGGCTCTGGTGTTGGCTATAAATGCACAAGACGTTGCAAGCTGCAAGGAGTATTTTGCGATCTTTTCC
ATCATCCAGCGCGAATCAGAGTTTCGCAACTACTATTACGCTGCTCGCAGGTCGAGTGTAATCACCTTGTGGCAG
ACAACTCGGCTTGCTGAGTGCGGTGAGGTTTCCGAGGAAGAAACGCGAGATGATCGCCAAACATTCACCGAATTT
CTCCGCAAATTCTACGATGCCTTGTCCTCTATCCTGAACATTGAACGTGCTCCAATATGCTCCATTTTTCCCGAC
CCGCGTAATACACTTTCTTCATTTATTGCGTCCACACTCTCAGCACTCCAACCCACCTATCCACAAAGGTTGTCT
TCTCTTGCCGAAAGAAAAAACGACGTGGTACTCACCGAACTTATTTCGGCATTGCGCCTAACTGAAGACTTTGCT
ATTTCTGTCGGAAAAATCATGGAGAAAGTCGAATTCGCGGCGGATGCACCAATGCCACGACGTTCGAGCATCTCC
GAGAAACCAACACACGCTCGAAGACGCTCGACTCGAATGTCGATATCTTGGCGCCATGGCCCAAACAAGTCCGTG
TCATCTAGTGGGATTCAACAAGCGCTCTCTCAGGCGAGCGAAGTTATGGAATGGGAGCAGGAACTGTTTCAGCCC
TTTCTTGATTTTCAAACAGACTATGGCTCTTTGGAGAAGCGATTTCTGGAGCATTCTCTAGCTGAAATAACGGCT
AGTGACGCGAAAGAACGAGTAGAGGATGTTGATCGACCAAGGTTGTTGCGAGAGCGGGCTGTTGATATTTTTGGC
CTTGCCGAAGGAAGTATGGGCAGGTGTAATGCGCTGACACACGGGTATGGGGCAGTAGGCCTTATTTGGGCCCTG
GATAATCTATTCAAGTCGTTCATGGAATCGTGGGCAACAGAGTTACAAACAAACAGGTCGAAAACCGTTTCGATA
GATAAATCGGTTGTCGAGGATGAGGACCTAGCGGATCTGGACTACACGGCTCATGACTGGTCCAATATTCAGCTG
TGTCTACATTTACTATCGTCTGCGCGCACGATCTCTGAGCGGCTGGCCGGATTTGAGATGAAGTTACGGAATTAC
TTGGCTCAGATTGCATCGCAGTTCCGTATGGCAAAGGATGATCCTGTCAACTTTACCATAGGGCCAGTACGAGGC
GAAGGGCAGCTCCTTGAGCAGTCGACGCTCAACTCAGTCGAGCTTCGAACGCTACTGGACACTATTGAGAATGAC
TCGACTCATTTTCGCCCTGGTCAAACTCACCCCCCTCATGAACCACTGCTTATGAATGCGCGCCGAGCATTATTC
CACTTCGCTCAAACGTGTCAAAATGCTCTTCAGAAGACGATCCTGTCCCCATTACGCCAACATCTTAGTTCTTAT
CCCTCTTCAATGATGTGGTCTACAGCGGGGGACCCAAGAAAGTCAGAAACTGACCTCAAAGTACCGACTTTCTCG
CTACCGCCCAGCGAGACGATGCAGAAAGTTGCTGGAGGATTGCTCAATTTACCAAGACTCTTTGAAGTCTATGCT
GATGATGACGCACTGTCCTTTGCACTTCAAACACTTCCACATCTAGATTTCGAGATGCTCAAAGGCCTTACGGAG
TCTTTGGTCACAGAGACTCCAGTTCCAAGCGGAGGTCATATGCGACGAGCCTCTGTGTCGTTTACCAGCAAGACG
AGTGTCGTTGACCCTGAAGCAGTCTCATCTGCATGGCTTCTCTCACTCGGCCATACATTCATAGGATACGTCACT
CAAGAGATTTTACCAGCAATCTCTTCTTTGTCGACCGCCGGTGCAGCCCAACTTGCGTCCGATCTAGAATATCTG
ATGAACATTGTACGCGCGCTGAATGTGGAGCACGAGGGACTGGAAAAATGGAGGATGTATGTGGAGATGGAAGAG
GAAGACATGAGAGCGAAGTTGGAAGACAATGAGGATACTGCAGACTCGATTCTTGCTGACATAGCTAGATTGCGT
GGGCTAGAGTAG
Transcript >Agabi119p4|042830
ATGTCGACATCCACAGCCGAAATAGTTGACTCCCTCGAGCAGTGTGGTGAAGTTATCTCCTGGATCAACGACACC
CTCATACCCTCTGACGACTCAGATGGTCTCAATATCGGCGTCGCTAGCCTTACAAAGCTTGACCAACAAATCACT
CAACTCCTTACAACCCTAGACATCGCCTCGGAGGACTCATCAACCCGGTTAGAACATATTATTGACGATGTATCG
CGTGGAATTCCTCGGCTTGCTTATGACCTTCATTTTATGAAAGATGGGGCACTGGCATTGCAGAGTAACCTTACG
GCCATCCTCCATCAGGCACGCGATACACTGCCCCCCAGCACGGATGTTGTCCTCAGACAATTGCACGAGCTGGAT
CTCATCAAGAGCCGAATGGAATCAGTAAGGGAAGTTCTACGGGAAGCTGAGAGTTGGAGTACATTGGAGATGGAA
GTGACATCTCTCATCGCGGAGAAGACTTATGCCAAGGCGGCGGAGCGACTCTCAGATGCCAGCAAAAGCATGGTG
GTCTTCCAAAACACTCCTGAATACGACCCGAGGCGAAATCTTATGATAAACCTGCAAAATCAACTTGAAGCCTCC
TTGAGTTCGGCTCTGGTGTTGGCTATAAATGCACAAGACGTTGCAAGCTGCAAGGAGTATTTTGCGATCTTTTCC
ATCATCCAGCGCGAATCAGAGTTTCGCAACTACTATTACGCTGCTCGCAGGTCGAGTGTAATCACCTTGTGGCAG
ACAACTCGGCTTGCTGAGTGCGGTGAGGTTTCCGAGGAAGAAACGCGAGATGATCGCCAAACATTCACCGAATTT
CTCCGCAAATTCTACGATGCCTTGTCCTCTATCCTGAACATTGAACGTGCTCCAATATGCTCCATTTTTCCCGAC
CCGCGTAATACACTTTCTTCATTTATTGCGTCCACACTCTCAGCACTCCAACCCACCTATCCACAAAGGTTGTCT
TCTCTTGCCGAAAGAAAAAACGACGTGGTACTCACCGAACTTATTTCGGCATTGCGCCTAACTGAAGACTTTGCT
ATTTCTGTCGGAAAAATCATGGAGAAAGTCGAATTCGCGGCGGATGCACCAATGCCACGACGTTCGAGCATCTCC
GAGAAACCAACACACGCTCGAAGACGCTCGACTCGAATGTCGATATCTTGGCGCCATGGCCCAAACAAGTCCGTG
TCATCTAGTGGGATTCAACAAGCGCTCTCTCAGGCGAGCGAAGTTATGGAATGGGAGCAGGAACTGTTTCAGCCC
TTTCTTGATTTTCAAACAGACTATGGCTCTTTGGAGAAGCGATTTCTGGAGCATTCTCTAGCTGAAATAACGGCT
AGTGACGCGAAAGAACGAGTAGAGGATGTTGATCGACCAAGGTTGTTGCGAGAGCGGGCTGTTGATATTTTTGGC
CTTGCCGAAGGAAGTATGGGCAGGTGTAATGCGCTGACACACGGGTATGGGGCAGTAGGCCTTATTTGGGCCCTG
GATAATCTATTCAAGTCGTTCATGGAATCGTGGGCAACAGAGTTACAAACAAACAGGTCGAAAACCGTTTCGATA
GATAAATCGGTTGTCGAGGATGAGGACCTAGCGGATCTGGACTACACGGCTCATGACTGGTCCAATATTCAGCTG
TGTCTACATTTACTATCGTCTGCGCGCACGATCTCTGAGCGGCTGGCCGGATTTGAGATGAAGTTACGGAATTAC
TTGGCTCAGATTGCATCGCAGTTCCGTATGGCAAAGGATGATCCTGTCAACTTTACCATAGGGCCAGTACGAGGC
GAAGGGCAGCTCCTTGAGCAGTCGACGCTCAACTCAGTCGAGCTTCGAACGCTACTGGACACTATTGAGAATGAC
TCGACTCATTTTCGCCCTGGTCAAACTCACCCCCCTCATGAACCACTGCTTATGAATGCGCGCCGAGCATTATTC
CACTTCGCTCAAACGTGTCAAAATGCTCTTCAGAAGACGATCCTGTCCCCATTACGCCAACATCTTAGTTCTTAT
CCCTCTTCAATGATGTGGTCTACAGCGGGGGACCCAAGAAAGTCAGAAACTGACCTCAAAGTACCGACTTTCTCG
CTACCGCCCAGCGAGACGATGCAGAAAGTTGCTGGAGGATTGCTCAATTTACCAAGACTCTTTGAAGTCTATGCT
GATGATGACGCACTGTCCTTTGCACTTCAAACACTTCCACATCTAGATTTCGAGATGCTCAAAGGCCTTACGGAG
TCTTTGGTCACAGAGACTCCAGTTCCAAGCGGAGGTCATATGCGACGAGCCTCTGTGTCGTTTACCAGCAAGACG
AGTGTCGTTGACCCTGAAGCAGTCTCATCTGCATGGCTTCTCTCACTCGGCCATACATTCATAGGATACGTCACT
CAAGAGATTTTACCAGCAATCTCTTCTTTGTCGACCGCCGGTGCAGCCCAACTTGCGTCCGATCTAGAATATCTG
ATGAACATTGTACGCGCGCTGAATGTGGAGCACGAGGGACTGGAAAAATGGAGGATGTATGTGGAGATGGAAGAG
GAAGACATGAGAGCGAAGTTGGAAGACAATGAGGATACTGCAGACTCGATTCTTGCTGACATAGCTAGATTGCGT
GGGCTAGAGTAG
Gene >Agabi119p4|042830
ATGTCGACATCCACAGCCGAAATAGTTGACTCCCTCGAGCAGTGTGGTGAAGTTATCTCCTGGATCAACGACACC
CTCATACCCTCTGACGACTCAGATGGTCTCAATATCGGCGTCGCTAGCCTTACAAAGCTTGACCAACAAATCACT
CAACTCCTTACAACCCTAGACATCGCCTCGGAGGACTCATCAACCCGGTTAGAACATATTATTGACGATGTATCG
CGTGGAATTCCTCGGCTTGCTTATGACCTTCATTTTATGAAAGATGGGGCACTGGCATTGCAGAGTAACCTTACG
GCCATCCTCCATCAGGCACGCGATACACTGCCCCCCAGCACGGATGTTGTCCTCAGACAATTGCACGAGCTGGAT
CTCATCAAGAGCCGAATGGAATCAGTAAGGGAAGTTCTACGGGAAGCTGAGAGTTGGAGTACATTGGAGATGGAA
GTGACATCTCTCATCGCGGAGAAGACTTATGCCAAGGCGGCGGAGCGACTCTCAGATGCCAGCAAAAGCATGGTG
GTCTTCCAAAACACTCCTGAATACGACCCGAGGCGAAATCTTATGATAAACCTGCAAAATCAACTTGAAGCCTCC
TTGAGTTCGGCTCTGGTGTTGGCTATAAATGCACAAGACGTTGCAAGCTGCAAGGAGTATTTTGCGATCTTTTCC
ATCATCCAGCGCGAATCAGAGTTTCGCAACTACTATTACGCTGCTCGCAGGTCGAGTGTAATCACCTTGTGGCAG
ACAACTCGGCTTGCTGAGTGCGGTGAGGTTTCCGAGGAAGAAACGCGAGATGATCGCCAAACATTCACCGAATTT
CTCCGCAAATTCTACGATGCCTTGTCCTCTATCCTGAACATTGAACGTGCTCCAATATGCTCCATTTTTCCCGAC
CCGCGTAATACACTTTCTTCATTTATTGCGTCCACACTCTCAGCACTCCAACCCACCTATCCACAAAGGTTGTCT
TCTCTTGCCGAAAGAAAAAACGACGTGGTACTCACCGAACTTATTTCGGCATTGCGCCTAACTGAAGACTTTGCT
ATTTCTGTCGGAAAAATCATGGAGAAAGTCGAATTCGCGGCGGATGCACCAATGCCACGACGTTCGAGCATCTCC
GAGAAACCAACACACGCTCGAAGACGCTCGACTCGAATGTCGATATCTTGGCGCCATGGCCCAAACAAGTCCGTG
TCATCTAGTGGGATTCAACAAGCGCTCTCTCAGGCGAGCGAAGTTATGGAATGGGAGCAGGAACTGTTTCAGCCC
TTTCTTGATTTTCAAACAGACTATGGCTCTTTGGAGAAGCGATTTCTGGAGCATTCTCTAGCTGAAATAACGGCT
AGTGACGCGAAAGAACGAGTAGAGGATGTTGATCGACCAAGGTTGTTGCGAGAGCGGGCTGTTGATATTTTTGGC
CTTGCCGAAGGAAGTATGGGCAGGTGTAATGCGCTGACACACGGGTATGGGGCAGTAGGCCTTATTTGGGCCCTG
GATAATCTATTCAAGTCGTTCATGGAATCGTGGGCAACAGAGTTACAAACAAACAGGTCGAAAACCGTTTCGATA
GATAAATCGGTTGTCGAGGATGAGGACCTAGCGGATCTGGACTACACGGCTCATGACTGGTCCAATATTCAGCTG
TGTCTACATTTACTATCGTCTGCGCGCACGATCTCTGAGCGGCTGGCCGGATTTGAGATGAAGTTACGGAATTAC
TTGGCTCAGATTGCATCGCAGTTCCGTATGGCAAAGGATGATCCTGTCAACTTTACCATAGGGCCAGTACGAGGC
GAAGGGCAGCTCCTTGAGCAGTCGACGCTCAACTCAGTCGAGCTTCGAACGCTACTGGACACTATTGAGAATGAC
TCGACTCATTTTCGCCCTGGTCAAACTCACCCCCCTCATGAACCACTGCTTATGAATGCGCGCCGAGCATTATTC
CACTTCGCTCAAACGTGTCAAAATGCTCTTCAGAAGACGATCCTGTCCCCATTACGCCAACATCTTAGTTCTTAT
CCCTCTTCAATGATGTGGTCTACAGCGGGGGACCCAAGAAAGTCAGAAACTGACCTCAAAGTACCGACTTTCTCG
CTACCGCCCAGCGAGACGATGCAGAAAGTTGCTGGAGGATTGCTCAATTTACCAAGACTCTTTGAAGTCTATGCT
GATGATGACGCACTGTCCTTTGCACTTCAAACACTTCCACATCTAGATTTCGAGATGCTCAAAGGCCTTACGGAG
TCTTTGGTCACAGAGACTCCAGTTCCAAGCGGAGGTCATATGCGACGAGCCTCTGTGTCGTTTACCAGCAAGACG
AGTGTCGTTGACCCTGAAGCAGTCTCATCTGCATGGCTTCTCTCACTCGGCCATACATTCATAGGATACGTCACT
CAAGAGATTTTACCAGCAATCTCTTCTTTGTCGACCGCCGGTGCAGCCCAACTTGCGTCCGATCTAGAATATCTG
ATGAACATTGTACGCGCGCTGAATGTGGAGCACGAGGGACTGGAAAAATGGAGGATGTATGTGGAGATGGAAGAG
GAAGACATGAGAGCGAAGTTGGAAGACAATGAGGATACTGCAGACTCGATTCTTGCTGACATAGCTAGATTGCGT
GGGCTAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail