Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|042420
Gene name
Locationscaffold_02:859637..860268
Strand+
Gene length (bp)631
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02179 BAG BAG domain 3.2E-20 88 170

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59739|BAG1B_SCHPO BAG family molecular chaperone regulator 1B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bag102 PE=1 SV=1 40 169 1.0E-07

GO

GO Term Description Terminal node
GO:0051087 chaperone binding Yes
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|042420
MLLKWQKQRFTVPFPGPAAPLAALRHHAAELSHLPPAAFKLIHAGAVMKDDAAPLSAYKLTENSTVFLIGDDPTT
PASASEHHSVSRIQAELSSVRSQLTPHVHAFLAALRPPSDMPPTPQDHTRLGELLLQSLLRLDAIAPERDWPTAR
AERKAAVREVQELLDNLDSAWAAYSNP*
Coding >Agabi119p4|042420
ATGCTCCTCAAGTGGCAGAAACAAAGATTCACCGTTCCCTTCCCCGGCCCCGCCGCACCCCTCGCCGCCCTCCGC
CACCATGCCGCAGAGCTTTCCCACCTTCCCCCCGCCGCTTTCAAGCTCATCCATGCCGGCGCAGTCATGAAAGAC
GACGCCGCCCCCCTGTCCGCCTACAAGCTCACCGAAAACTCCACCGTCTTTCTGATCGGAGACGACCCGACCACC
CCTGCCTCTGCCTCTGAGCACCACTCCGTCTCCCGCATCCAAGCAGAACTCTCCTCCGTCCGCTCCCAGCTCACC
CCCCACGTCCACGCCTTCCTCGCCGCCCTCCGCCCCCCATCCGACATGCCTCCCACCCCGCAGGACCACACCCGT
CTCGGCGAATTGCTTCTCCAGTCTCTCCTCCGTCTTGACGCAATCGCTCCGGAGCGCGACTGGCCGACCGCCCGT
GCAGAGCGCAAGGCCGCTGTCCGAGAAGTCCAGGAGCTTCTCGACAATCTAGACTCGGCCTGGGCTGCCTATTCA
AATCCGTAA
Transcript >Agabi119p4|042420
ATGCTCCTCAAGTGGCAGAAACAAAGATTCACCGTTCCCTTCCCCGGCCCCGCCGCACCCCTCGCCGCCCTCCGC
CACCATGCCGCAGAGCTTTCCCACCTTCCCCCCGCCGCTTTCAAGCTCATCCATGCCGGCGCAGTCATGAAAGAC
GACGCCGCCCCCCTGTCCGCCTACAAGCTCACCGAAAACTCCACCGTCTTTCTGATCGGAGACGACCCGACCACC
CCTGCCTCTGCCTCTGAGCACCACTCCGTCTCCCGCATCCAAGCAGAACTCTCCTCCGTCCGCTCCCAGCTCACC
CCCCACGTCCACGCCTTCCTCGCCGCCCTCCGCCCCCCATCCGACATGCCTCCCACCCCGCAGGACCACACCCGT
CTCGGCGAATTGCTTCTCCAGTCTCTCCTCCGTCTTGACGCAATCGCTCCGGAGCGCGACTGGCCGACCGCCCGT
GCAGAGCGCAAGGCCGCTGTCCGAGAAGTCCAGGAGCTTCTCGACAATCTAGACTCGGCCTGGGCTGCCTATTCA
AATCCGTAA
Gene >Agabi119p4|042420
ATGCTCCTCAAGTGGCAGAAACAAAGGCACGCCCTCTCTCCCAGCCCACTGACCGACACTGACTCCCTTCACAGA
TTCACCGTTCCCTTCCCCGGCCCCGCCGCACCCCTCGCCGCCCTCCGCCACCATGCCGCAGAGCTTTCCCACCTT
CCCCCCGCCGCTTTCAAGCTCATCCATGCCGGCGCAGTCATGAAAGACGACGCCGCCCCCCGTACGCTCTCTTTT
TTTCTTACTCAACCCCTCGCTCACGTTGCTGTCAGTGTCCGCCTACAAGCTCACCGAAAACTCCACCGTCTTTCT
GATCGGAGACGACCCGACCACCCCTGCCTCTGCCTCTGAGCACCACTCCGTCTCCCGCATCCAAGCAGAACTCTC
CTCCGTCCGCTCCCAGCTCACCCCCCACGTCCACGCCTTCCTCGCCGCCCTCCGCCCCCCATCCGACATGCCTCC
CACCCCGCAGGACCACACCCGTCTCGGCGAATTGCTTCTCCAGTCTCTCCTCCGTCTTGACGCAATCGCTCCGGA
GCGCGACTGGCCGACCGCCCGTGCAGAGCGCAAGGCCGCTGTCCGAGAAGTCCAGGAGCTTCTCGACAATCTAGA
CTCGGCCTGGGCTGCCTATTCAAATCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail