Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|041880
Gene name
Locationscaffold_02:723721..725377
Strand-
Gene length (bp)1656
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 2.8E-99 14 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 10 395 5.0E-51
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 31 395 4.0E-50
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 28 394 2.0E-46
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 28 394 3.0E-46
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 28 394 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 10 395 5.0E-51
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 31 395 4.0E-50
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 28 394 2.0E-46
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 28 394 3.0E-46
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 28 394 9.0E-46
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 28 394 3.0E-45
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 84 106 22
3 119 138 19
4 166 188 22
5 216 238 22
6 267 289 22
7 296 315 19
8 338 360 22
9 369 391 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|041880
MPPSTSGLNAAALALVATRIVAALFSPENVLKRDQLLSTPLSSYTQLREGIFLFKHNIDPYSGGTFRHSPLLLAL
FSTILPNSRTFASLLWTAFDLLGAWALVSIWRARQNVSHTSRDILVAASYLLNPYVFLPTLALSSSSFQSSLTLL
SVKYAAEGNASLALFLLAILLHIDLSTFILLPPVLLLLITGPRSHLASPHALAANLLRIIPHFSRYLLYTGILAI
VSTSITGGTRWISQTWGATLTLPDLTPNTGLWWYFFTEMFDHFRPFFLMVFTLHLSIYAIPMCIKFQYDPLYATF
LLLGVLGTFKAYPTLSDPGLFLSALALFPEVYPYLRHQMVTALLHLHAALLMPLFNYLWLSTGTGNANFFYASTL
VFACANGAALIDAIWAGLRIAIGEEKEGYMVVQE*
Coding >Agabi119p4|041880
ATGCCTCCTTCGACGAGTGGACTCAATGCGGCAGCGCTGGCTCTCGTCGCAACCAGGATAGTCGCCGCTCTCTTC
TCTCCCGAAAATGTCCTCAAGCGCGACCAGTTGTTATCTACGCCACTGTCCTCTTATACCCAACTCAGGGAGGGC
ATTTTCCTTTTCAAACACAACATAGACCCATATTCTGGTGGGACCTTTCGACATTCTCCCCTCCTTCTCGCGTTA
TTTTCCACCATACTGCCCAATTCGCGAACCTTCGCATCGCTCCTGTGGACAGCTTTTGACTTATTGGGTGCTTGG
GCACTTGTGTCAATATGGAGGGCGCGACAAAATGTATCGCACACGTCAAGAGATATTTTGGTCGCCGCGAGTTAT
CTATTGAACCCCTACGTTTTTCTACCCACTTTGGCTCTTTCATCTTCCAGTTTTCAATCATCTTTGACTCTTCTC
TCAGTCAAGTATGCAGCCGAAGGAAACGCGTCTCTAGCGCTCTTCTTGCTAGCAATACTTCTTCATATCGATCTC
TCAACATTTATCCTTCTTCCCCCAGTTCTTCTTCTACTCATTACTGGCCCACGCTCTCATCTCGCATCTCCACAC
GCCCTAGCTGCCAACCTTCTTCGTATCATTCCACACTTCTCCAGATACTTGTTATACACAGGTATTCTTGCCATT
GTATCAACAAGTATCACAGGCGGTACGCGATGGATATCACAAACTTGGGGAGCCACGCTTACTTTACCTGATTTG
ACCCCAAACACAGGTCTATGGTGGTATTTTTTCACGGAAATGTTTGACCATTTTCGTCCGTTCTTCCTCATGGTC
TTCACTCTTCATCTCTCGATCTATGCGATACCTATGTGCATCAAGTTTCAGTACGATCCTTTATATGCTACCTTC
CTCCTTCTCGGCGTACTAGGGACGTTCAAGGCGTACCCAACGTTGTCAGATCCTGGCCTATTCCTTAGTGCCCTC
GCATTGTTTCCCGAAGTCTACCCTTATCTCAGACATCAAATGGTCACTGCACTTCTTCATCTTCATGCAGCACTG
CTTATGCCCCTCTTCAATTACTTGTGGCTCAGTACCGGGACTGGCAATGCCAATTTCTTTTATGCCTCAACGTTG
GTTTTCGCTTGCGCAAATGGGGCCGCGCTTATTGATGCCATTTGGGCTGGCTTGCGCATTGCAATTGGTGAAGAG
AAGGAGGGTTATATGGTTGTACAAGAATGA
Transcript >Agabi119p4|041880
ATGCCTCCTTCGACGAGTGGACTCAATGCGGCAGCGCTGGCTCTCGTCGCAACCAGGATAGTCGCCGCTCTCTTC
TCTCCCGAAAATGTCCTCAAGCGCGACCAGTTGTTATCTACGCCACTGTCCTCTTATACCCAACTCAGGGAGGGC
ATTTTCCTTTTCAAACACAACATAGACCCATATTCTGGTGGGACCTTTCGACATTCTCCCCTCCTTCTCGCGTTA
TTTTCCACCATACTGCCCAATTCGCGAACCTTCGCATCGCTCCTGTGGACAGCTTTTGACTTATTGGGTGCTTGG
GCACTTGTGTCAATATGGAGGGCGCGACAAAATGTATCGCACACGTCAAGAGATATTTTGGTCGCCGCGAGTTAT
CTATTGAACCCCTACGTTTTTCTACCCACTTTGGCTCTTTCATCTTCCAGTTTTCAATCATCTTTGACTCTTCTC
TCAGTCAAGTATGCAGCCGAAGGAAACGCGTCTCTAGCGCTCTTCTTGCTAGCAATACTTCTTCATATCGATCTC
TCAACATTTATCCTTCTTCCCCCAGTTCTTCTTCTACTCATTACTGGCCCACGCTCTCATCTCGCATCTCCACAC
GCCCTAGCTGCCAACCTTCTTCGTATCATTCCACACTTCTCCAGATACTTGTTATACACAGGTATTCTTGCCATT
GTATCAACAAGTATCACAGGCGGTACGCGATGGATATCACAAACTTGGGGAGCCACGCTTACTTTACCTGATTTG
ACCCCAAACACAGGTCTATGGTGGTATTTTTTCACGGAAATGTTTGACCATTTTCGTCCGTTCTTCCTCATGGTC
TTCACTCTTCATCTCTCGATCTATGCGATACCTATGTGCATCAAGTTTCAGTACGATCCTTTATATGCTACCTTC
CTCCTTCTCGGCGTACTAGGGACGTTCAAGGCGTACCCAACGTTGTCAGATCCTGGCCTATTCCTTAGTGCCCTC
GCATTGTTTCCCGAAGTCTACCCTTATCTCAGACATCAAATGGTCACTGCACTTCTTCATCTTCATGCAGCACTG
CTTATGCCCCTCTTCAATTACTTGTGGCTCAGTACCGGGACTGGCAATGCCAATTTCTTTTATGCCTCAACGTTG
GTTTTCGCTTGCGCAAATGGGGCCGCGCTTATTGATGCCATTTGGGCTGGCTTGCGCATTGCAATTGGTGAAGAG
AAGGAGGGTTATATGGTTGTACAAGAATGA
Gene >Agabi119p4|041880
ATGCCTCCTTCGACGAGTGGACTCAATGCGGCAGCGCTGGCTCTCGTCGCAACCAGGATAGTCGCCGCTCTCTTC
TCTCCCGAAAATGTCCTCAAGCGCGACCAGTTGTTATCTACGCCACTGTCCTCTTATACCCAACGTTAGTGTCTT
CATTTGCATTACAGTGCTACTCAACATATTGTCTGTTCAGTCAGGGAGGGCATTTTCCTTTTCAAACACAACATA
GACCCATATTCTGGTGGGACCTTTCGACATGTACCCCGTTATCCTCACTTGTATCTGCAATCAGAGGGTTAACCT
GTCGTTCTAGTCTCCCCTCCTTCTCGCGTTATTTTCCACCATACTGCCCAATTCGCGAACCTTCGCATCGCTCCT
GTGGACAGCTTTTGACTTATTGGGTGCTTGGGCACTTGTGTCAATATGGAGGGCGCGACAAAATGTATCGCACAC
GTCAAGAGATATTTTGGTCGCCGCGAGGTGTGAATCGAACTATTGAAACGGCAATATCGTTTATAACTTAGCCCT
ACAGTTATCTATTGAACCCCTACGTTTTTCTACCCACTTTGGCTCTTTCATCTTCCAGTTTTCAATCATCTTTGA
CTCTTCTCTCAGTCAAGTATGCAGCCGAAGGTGGGTATCGCCAATACTACTCAGACGAATCTTGTCTCATTCTTT
ATACAGGAAACGCGTCTCTAGCGCTCTTCTTGCTAGCAATACTTCTTCATATCGATCTCTCAACATTTATCCTTC
TTCCCCCAGTTCTTCTTCTACTCATTACTGGCCCACGCTCTCATCTCGCATCTCCACACGCCCTAGCTGCCAACC
TTCTTCGTATCATTCCACACTTCTCCAGATACTTGTTATACACAGGTATTCTTGCCATTGTATCAACAAGTATCA
CAGGCGGTACGCGATGGATATCACAAACTTGGGGAGCCACGTATGTTTTCCTGTTCTTTCGTTCATCACACCCAC
CTGAGTTTGATTGCTGCCCAGGCTTACTTTACCTGATTTGACCCCAAACACAGGTCTATGGTGGTATTTTTTCAC
GGAAATGTTTGACCATTTTCGTCCGTTCTTCCTCATGGTCTTCACTGTGAGGCTCGACTTTTTTGATTTCACTAT
TATAATACTAACATCGATTCTAGCTTCATCTCTCGATCTATGCGATACCTATGTGCATCAAGTTTCAGTACGTTC
TCTCCCCTTCTCTTTTCTTGTCTCGATTCACATGACATCTACAGGTACGATCCTTTATATGCTACCTTCCTCCTT
CTCGGCGTACTAGGGACGTTCAAGGCGTACCCAACGTTGTCAGATCCTGGCCTATTCCTTAGTGCCCTCGCATTG
TTTCCCGAAGTCTACCCTTGTGAGATTCCTATGCAACGGGCTTGTTCTTTCCTAGCTGATTAGATTGCACTTCCA
GATCTCAGACATCAAATGGTCACTGCACTTCTTCATCTTCATGCAGCACTGCTTATGCCCCTCTTCAATTACTTG
TGGCTCAGTACCGGGACTGGCAATGCCAATTTCTTTTATGCCTCAACGTTGGTTTTCGCTTGCGCAAATGGGGCC
GCGCTTATTGATGCCATTTGGGCTGGCTTGCGCATTGCAATTGGTGAAGAGAAGGAGGGTTATATGGTTGTACAA
GAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail