Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|041780
Gene name
Locationscaffold_02:700100..700908
Strand+
Gene length (bp)808
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 1.1E-10 114 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 82 201 5.0E-21
sp|Q8L8T2|GRXC1_ARATH Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2 104 206 2.0E-18
sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 104 201 2.0E-17
sp|Q9ZR41|GLRX_SOLLC Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1 103 202 3.0E-17
sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 103 201 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 82 201 5.0E-21
sp|Q8L8T2|GRXC1_ARATH Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2 104 206 2.0E-18
sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 104 201 2.0E-17
sp|Q9ZR41|GLRX_SOLLC Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1 103 202 3.0E-17
sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 103 201 5.0E-17
sp|Q9FNE2|GRXC2_ARATH Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1 104 201 1.0E-16
sp|P38068|GLRX7_YEAST Monothiol glutaredoxin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX7 PE=1 SV=1 94 199 2.0E-16
sp|B7ZFT1|GLRX1_RHIID Glutaredoxin-1 OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GRX1 PE=2 SV=3 104 197 3.0E-15
sp|Q0J3L4|GRS10_ORYSJ Monothiol glutaredoxin-S10 OS=Oryza sativa subsp. japonica GN=GRXS10 PE=2 SV=2 113 206 4.0E-15
sp|Q9UTI2|GLRX2_SCHPO Glutaredoxin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx2 PE=3 SV=1 106 199 1.0E-14
sp|Q6H628|GRXS6_ORYSJ Monothiol glutaredoxin-S6 OS=Oryza sativa subsp. japonica GN=GRXS6 PE=2 SV=1 114 200 1.0E-14
sp|Q8LFQ6|GRXC4_ARATH Glutaredoxin-C4 OS=Arabidopsis thaliana GN=GRXC4 PE=2 SV=2 87 210 3.0E-14
sp|O81187|GLRX_VERFO Glutaredoxin OS=Vernicia fordii PE=3 SV=1 104 202 8.0E-14
sp|Q9Y7N3|GLRX3_SCHPO Monothiol glutaredoxin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx3 PE=3 SV=3 107 199 2.0E-13
sp|Q0DAE4|GRXC8_ORYSJ Glutaredoxin-C8 OS=Oryza sativa subsp. japonica GN=GRXC8 PE=2 SV=2 112 197 2.0E-13
sp|Q8LBS4|GRS12_ARATH Monothiol glutaredoxin-S12, chloroplastic OS=Arabidopsis thaliana GN=GRXS12 PE=1 SV=2 110 200 6.0E-13
sp|Q9FVX1|GRXC3_ARATH Glutaredoxin-C3 OS=Arabidopsis thaliana GN=GRXC3 PE=2 SV=1 114 197 6.0E-12
sp|Q19297|YZ73_CAEEL Uncharacterized monothiol glutaredoxin F10D7.3 OS=Caenorhabditis elegans GN=F10D7.3 PE=3 SV=2 112 207 1.0E-11
sp|Q54GP8|GLRX_DICDI Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1 104 201 5.0E-11
sp|Q12438|GLRX6_YEAST Monothiol glutaredoxin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX6 PE=1 SV=1 113 208 3.0E-10
sp|Q9LIF1|GRS10_ARATH Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana GN=GRXS10 PE=3 SV=1 107 201 3.0E-10
sp|P17695|GLRX2_YEAST Glutaredoxin-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX2 PE=1 SV=3 100 198 4.0E-10
sp|Q8GWS0|GRXC5_ARATH Glutaredoxin-C5, chloroplastic OS=Arabidopsis thaliana GN=GRXC5 PE=1 SV=1 114 200 9.0E-10
sp|Q32L67|GLRX2_BOVIN Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1 95 208 1.0E-09
sp|Q8L8Z8|GRXS2_ARATH Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1 113 201 2.0E-09
sp|P12309|GLRX1_PIG Glutaredoxin-1 OS=Sus scrofa GN=GLRX PE=1 SV=2 108 201 3.0E-09
sp|O36032|GLRX1_SCHPO Glutaredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx1 PE=3 SV=1 114 200 6.0E-09
sp|Q9NS18|GLRX2_HUMAN Glutaredoxin-2, mitochondrial OS=Homo sapiens GN=GLRX2 PE=1 SV=1 106 200 2.0E-08
sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 114 199 2.0E-08
sp|O23421|GRXS3_ARATH Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1 106 201 3.0E-08
sp|Q6AXW1|GLRX2_RAT Glutaredoxin-2, mitochondrial OS=Rattus norvegicus GN=Glrx2 PE=2 SV=2 95 200 4.0E-08
sp|Q923X4|GLRX2_MOUSE Glutaredoxin-2, mitochondrial OS=Mus musculus GN=Glrx2 PE=1 SV=1 106 208 4.0E-08
sp|Q5RC53|GLRX2_PONAB Glutaredoxin-2, mitochondrial OS=Pongo abelii GN=GLRX2 PE=2 SV=1 106 200 6.0E-08
sp|P12864|GLRX1_RABIT Glutaredoxin-1 OS=Oryctolagus cuniculus GN=GLRX PE=1 SV=1 106 201 7.0E-08
sp|Q6NLU2|GRXS7_ARATH Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2 104 201 8.0E-08
sp|Q86VQ6|TRXR3_HUMAN Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 114 199 9.0E-08
sp|O23419|GRXS4_ARATH Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1 104 201 1.0E-07
sp|Q9ESH6|GLRX1_RAT Glutaredoxin-1 OS=Rattus norvegicus GN=Glrx PE=3 SV=3 106 201 1.0E-07
sp|O23420|GRXS5_ARATH Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1 106 201 1.0E-07
sp|P10575|GLRX1_BOVIN Glutaredoxin-1 OS=Bos taurus GN=GLRX PE=1 SV=3 108 201 2.0E-07
sp|Q9SA68|GRXS1_ARATH Monothiol glutaredoxin-S1 OS=Arabidopsis thaliana GN=GRXS1 PE=3 SV=1 113 201 2.0E-07
sp|O23417|GRXS8_ARATH Monothiol glutaredoxin-S8 OS=Arabidopsis thaliana GN=GRXS8 PE=3 SV=1 104 201 3.0E-07
sp|P35754|GLRX1_HUMAN Glutaredoxin-1 OS=Homo sapiens GN=GLRX PE=1 SV=2 106 201 9.0E-07
sp|Q9QUH0|GLRX1_MOUSE Glutaredoxin-1 OS=Mus musculus GN=Glrx PE=1 SV=3 106 201 9.0E-07
sp|Q9LYC5|GRC14_ARATH Glutaredoxin-C14 OS=Arabidopsis thaliana GN=GRXC14 PE=3 SV=1 104 198 1.0E-06
sp|P25373|GLRX1_YEAST Glutaredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX1 PE=1 SV=1 114 185 4.0E-06
sp|O82255|GRC13_ARATH Glutaredoxin-C13 OS=Arabidopsis thaliana GN=GRXC13 PE=3 SV=1 104 198 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0016491 oxidoreductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0015035 protein-disulfide reductase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|041780
MSTRRTLIRLLLLVFVVSAFIWTFGSHLPESWKDTGILAYPLSRANILRAQKQTNELYGLLYLVTTDSEENQHIL
ADRVDLDPSEPIALEVYAAGNKALDWTAKTEEINSKYPVIVFSKTFCPFSKKAKELLTRYDLQPPPKIIEVDIRA
DSSTLKVLLTRLTHHSTFPNVIIRGKSIGGSDDLQALHKNHTLSDLLKEAGVSVQNKEVQ*
Coding >Agabi119p4|041780
ATGTCCACCCGTCGCACGCTAATTCGCCTCTTACTTCTAGTCTTCGTCGTCTCAGCGTTCATCTGGACCTTTGGC
TCGCACCTGCCGGAGTCCTGGAAAGACACAGGCATCTTAGCATATCCGTTATCACGTGCTAACATTCTACGAGCC
CAGAAGCAAACAAATGAGCTCTATGGCTTGCTCTATCTTGTCACCACTGACTCGGAAGAGAATCAACATATTTTG
GCCGATAGAGTGGATCTGGACCCATCCGAGCCAATTGCCCTGGAGGTCTACGCTGCTGGAAACAAGGCTCTTGAC
TGGACTGCTAAGACAGAAGAAATAAATTCAAAGTATCCCGTCATCGTGTTCAGCAAGACTTTTTGCCCATTTTCA
AAGAAAGCCAAAGAACTGCTGACCAGGTATGATCTGCAGCCGCCCCCTAAAATTATCGAGGTAGACATCAGAGCC
GACTCGAGCACGCTCAAGGTCCTTCTTACCCGCCTTACCCATCATTCCACCTTTCCCAACGTCATTATCCGCGGC
AAGTCCATTGGGGGTTCAGACGACTTGCAAGCGTTACATAAAAACCATACTCTCTCTGATTTGCTGAAGGAAGCC
GGGGTGTCGGTTCAGAATAAAGAGGTTCAATGA
Transcript >Agabi119p4|041780
ATGTCCACCCGTCGCACGCTAATTCGCCTCTTACTTCTAGTCTTCGTCGTCTCAGCGTTCATCTGGACCTTTGGC
TCGCACCTGCCGGAGTCCTGGAAAGACACAGGCATCTTAGCATATCCGTTATCACGTGCTAACATTCTACGAGCC
CAGAAGCAAACAAATGAGCTCTATGGCTTGCTCTATCTTGTCACCACTGACTCGGAAGAGAATCAACATATTTTG
GCCGATAGAGTGGATCTGGACCCATCCGAGCCAATTGCCCTGGAGGTCTACGCTGCTGGAAACAAGGCTCTTGAC
TGGACTGCTAAGACAGAAGAAATAAATTCAAAGTATCCCGTCATCGTGTTCAGCAAGACTTTTTGCCCATTTTCA
AAGAAAGCCAAAGAACTGCTGACCAGGTATGATCTGCAGCCGCCCCCTAAAATTATCGAGGTAGACATCAGAGCC
GACTCGAGCACGCTCAAGGTCCTTCTTACCCGCCTTACCCATCATTCCACCTTTCCCAACGTCATTATCCGCGGC
AAGTCCATTGGGGGTTCAGACGACTTGCAAGCGTTACATAAAAACCATACTCTCTCTGATTTGCTGAAGGAAGCC
GGGGTGTCGGTTCAGAATAAAGAGGTTCAATGA
Gene >Agabi119p4|041780
ATGTCCACCCGTCGCACGCTAATTCGCCTCTTACTTCTAGTCTTCGTCGTCTCAGCGTTCATCTGGACCTTTGGC
TCGCACCTGCCGGAGTCCTGGAAAGACACAGGCATCTTAGCATATCCGTTATCACGTGCTAACATTCTACGAGCC
CAGAAGCAAACAAATGAGCTCTATGGCTTGCTCTATCTTGTCACCACTGACTCGGAAGAGAATCAACATATTTTG
GCCGATAGAGTGGATCTGGACCCATCCGAGCCAATTGCCCTGGAGGTCTACGCTGCTGGAAACAAGGCTCTTGAC
TGGACTGCTAAGACAGAAGAAATAAATTCAAAGTATCCCGTCATCGTGTTCAGCAAGGTAGGTCTTTGGTTCAAC
ATAGAACGAGTTCCGTCTTTTGTTCTGACACACTTGAATAGACTTTTTGCCCGTGTGTACACCTCGCCACATTTT
TGCCATGCTTGACGCTGAATTCTTCGCTTCCCTAGATTTTCAAAGAAAGCCAAAGAACTGCTGACCAGGTATGAT
CTGCAGCCGCCCCCTAAAATTATCGAGGTAGACATCAGAGGTAACCCTTTTTCTTTCATGCCTGAATAATACGCA
TTTTTGACTTGAACTGTGACCAGCCGACTCGAGCACGCTCAAGGTCCTTCTTACCCGCCTTACCCATCATTCCAC
CTTTCCCAACGTCATTATCCGCGGCAAGTCCATTGGGGGTTCAGACGACTTGCAAGCGTTACATAAAAACCATAC
TCTCTCTGATTTGCTGAAGGAAGCCGGGGTGTCGGTTCAGAATAAAGAGGTTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail