Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|041620
Gene name
Locationscaffold_02:669187..669985
Strand+
Gene length (bp)798
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00213 OSCP ATP synthase delta (OSCP) subunit 1.4E-36 24 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P602|ATPO_NEUCR ATP synthase subunit 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-5 PE=3 SV=2 28 218 1.0E-28
sp|P22778|ATPO_IPOBA ATP synthase subunit O, mitochondrial OS=Ipomoea batatas PE=1 SV=1 24 216 3.0E-27
sp|Q75EZ3|ATPO_ASHGO ATP synthase subunit 5, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP5 PE=3 SV=1 28 218 2.0E-26
sp|Q9DB20|ATPO_MOUSE ATP synthase subunit O, mitochondrial OS=Mus musculus GN=Atp5o PE=1 SV=1 24 216 7.0E-26
sp|Q5RD23|ATPO_PONAB ATP synthase subunit O, mitochondrial OS=Pongo abelii GN=ATP5O PE=2 SV=1 24 217 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P602|ATPO_NEUCR ATP synthase subunit 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-5 PE=3 SV=2 28 218 1.0E-28
sp|P22778|ATPO_IPOBA ATP synthase subunit O, mitochondrial OS=Ipomoea batatas PE=1 SV=1 24 216 3.0E-27
sp|Q75EZ3|ATPO_ASHGO ATP synthase subunit 5, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP5 PE=3 SV=1 28 218 2.0E-26
sp|Q9DB20|ATPO_MOUSE ATP synthase subunit O, mitochondrial OS=Mus musculus GN=Atp5o PE=1 SV=1 24 216 7.0E-26
sp|Q5RD23|ATPO_PONAB ATP synthase subunit O, mitochondrial OS=Pongo abelii GN=ATP5O PE=2 SV=1 24 217 5.0E-25
sp|P09457|ATPO_YEAST ATP synthase subunit 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP5 PE=1 SV=1 28 218 7.0E-25
sp|P48047|ATPO_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens GN=ATP5O PE=1 SV=1 24 218 1.0E-24
sp|O74190|ATPO_KLULA ATP synthase subunit 5, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP5 PE=3 SV=2 28 218 1.0E-24
sp|Q2EN81|ATPO_PIG ATP synthase subunit O, mitochondrial OS=Sus scrofa GN=ATP5O PE=1 SV=1 24 216 3.0E-24
sp|Q06647|ATPO_RAT ATP synthase subunit O, mitochondrial OS=Rattus norvegicus GN=Atp5o PE=1 SV=1 24 216 9.0E-24
sp|B3EX21|ATPO_SORAR ATP synthase subunit O, mitochondrial OS=Sorex araneus GN=ATP5O PE=3 SV=1 24 218 1.0E-23
sp|B1MT69|ATPO_CALMO ATP synthase subunit O, mitochondrial OS=Callicebus moloch GN=ATP5O PE=3 SV=1 24 218 2.0E-23
sp|P13621|ATPO_BOVIN ATP synthase subunit O, mitochondrial OS=Bos taurus GN=ATP5O PE=1 SV=2 24 216 6.0E-23
sp|B0VXH3|ATPO_CALJA ATP synthase subunit O, mitochondrial OS=Callithrix jacchus GN=ATP5O PE=3 SV=1 24 218 8.0E-23
sp|B2B9A1|ATPO_RHIFE ATP synthase subunit O, mitochondrial OS=Rhinolophus ferrumequinum GN=ATP5O PE=3 SV=1 24 216 1.0E-22
sp|Q6FSD5|ATPO_CANGA ATP synthase subunit 5, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATP5 PE=3 SV=1 28 218 1.0E-21
sp|Q96251|ATPO_ARATH ATP synthase subunit O, mitochondrial OS=Arabidopsis thaliana GN=At5g13450 PE=1 SV=2 44 218 1.0E-21
sp|Q24439|ATPO_DROME ATP synthase subunit O, mitochondrial OS=Drosophila melanogaster GN=ATPsynO PE=2 SV=2 27 215 2.0E-20
sp|O74479|ATPO_SCHPO ATP synthase subunit 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp5 PE=3 SV=2 6 218 3.0E-20
sp|B6JD05|ATPD_OLICO ATP synthase subunit delta OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=atpH PE=3 SV=1 22 217 4.0E-20
sp|Q1QQS4|ATPD_NITHX ATP synthase subunit delta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpH PE=3 SV=2 22 217 2.0E-19
sp|Q2G5N8|ATPD_NOVAD ATP synthase subunit delta OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpH PE=3 SV=2 22 215 1.0E-18
sp|Q28TJ9|ATPD_JANSC ATP synthase subunit delta OS=Jannaschia sp. (strain CCS1) GN=atpH PE=3 SV=1 21 216 2.0E-18
sp|Q3SVJ5|ATPD_NITWN ATP synthase subunit delta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpH PE=3 SV=2 22 217 2.0E-18
sp|A4YKD7|ATPD_BRASO ATP synthase subunit delta OS=Bradyrhizobium sp. (strain ORS278) GN=atpH PE=3 SV=2 22 217 4.0E-18
sp|A5E947|ATPD_BRASB ATP synthase subunit delta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpH PE=3 SV=1 22 217 4.0E-18
sp|A5V3X2|ATPD_SPHWW ATP synthase subunit delta OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpH PE=3 SV=1 22 210 4.0E-18
sp|Q2N8Z6|ATPD_ERYLH ATP synthase subunit delta OS=Erythrobacter litoralis (strain HTCC2594) GN=atpH PE=3 SV=2 22 215 7.0E-18
sp|Q21CY4|ATPD_RHOPB ATP synthase subunit delta OS=Rhodopseudomonas palustris (strain BisB18) GN=atpH PE=3 SV=2 22 217 1.0E-17
sp|Q2J3I1|ATPD_RHOP2 ATP synthase subunit delta OS=Rhodopseudomonas palustris (strain HaA2) GN=atpH PE=3 SV=1 22 217 1.0E-17
sp|B3Q748|ATPD_RHOPT ATP synthase subunit delta OS=Rhodopseudomonas palustris (strain TIE-1) GN=atpH PE=3 SV=1 22 217 1.0E-17
sp|Q6NDC9|ATPD_RHOPA ATP synthase subunit delta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpH PE=3 SV=1 22 217 1.0E-17
sp|A6UDM4|ATPD_SINMW ATP synthase subunit delta OS=Sinorhizobium medicae (strain WSM419) GN=atpH PE=3 SV=1 22 216 1.0E-17
sp|A7HT49|ATPD_PARL1 ATP synthase subunit delta OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpH PE=3 SV=1 22 213 2.0E-17
sp|Q13DP5|ATPD_RHOPS ATP synthase subunit delta OS=Rhodopseudomonas palustris (strain BisB5) GN=atpH PE=3 SV=1 22 217 3.0E-17
sp|P05437|ATPD_RHOBL ATP synthase subunit delta OS=Rhodobacter blasticus GN=atpH PE=3 SV=1 24 216 3.0E-17
sp|Q07UZ2|ATPD_RHOP5 ATP synthase subunit delta OS=Rhodopseudomonas palustris (strain BisA53) GN=atpH PE=3 SV=1 22 217 4.0E-17
sp|Q92LK5|ATPD_RHIME ATP synthase subunit delta OS=Rhizobium meliloti (strain 1021) GN=atpH PE=3 SV=2 22 216 7.0E-17
sp|Q57B85|ATPD_BRUAB ATP synthase subunit delta OS=Brucella abortus biovar 1 (strain 9-941) GN=atpH PE=3 SV=1 22 210 1.0E-16
sp|Q2YLI4|ATPD_BRUA2 ATP synthase subunit delta OS=Brucella abortus (strain 2308) GN=atpH PE=3 SV=1 22 210 1.0E-16
sp|B2S7M6|ATPD_BRUA1 ATP synthase subunit delta OS=Brucella abortus (strain S19) GN=atpH PE=3 SV=1 22 210 1.0E-16
sp|Q8FYR2|ATPD_BRUSU ATP synthase subunit delta OS=Brucella suis biovar 1 (strain 1330) GN=atpH PE=3 SV=1 22 210 1.0E-16
sp|A9WWS5|ATPD_BRUSI ATP synthase subunit delta OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpH PE=3 SV=1 22 210 2.0E-16
sp|A5VSE4|ATPD_BRUO2 ATP synthase subunit delta OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpH PE=3 SV=1 22 210 2.0E-16
sp|A9M840|ATPD_BRUC2 ATP synthase subunit delta OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpH PE=3 SV=1 22 210 2.0E-16
sp|B9JBZ8|ATPD_AGRRK ATP synthase subunit delta OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=atpH PE=3 SV=2 22 216 3.0E-16
sp|Q89X71|ATPD_BRADU ATP synthase subunit delta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpH PE=3 SV=1 22 217 5.0E-16
sp|Q98EV5|ATPD_RHILO ATP synthase subunit delta OS=Rhizobium loti (strain MAFF303099) GN=atpH PE=3 SV=1 22 213 7.0E-16
sp|A6WXW8|ATPD_OCHA4 ATP synthase subunit delta OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpH PE=3 SV=1 22 216 8.0E-16
sp|B5ZSP0|ATPD_RHILW ATP synthase subunit delta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpH PE=3 SV=1 22 216 9.0E-16
sp|B9KPI5|ATPD_RHOSK ATP synthase subunit delta OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpH PE=3 SV=1 22 216 1.0E-15
sp|Q3J434|ATPD_RHOS4 ATP synthase subunit delta OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpH PE=3 SV=1 22 216 1.0E-15
sp|A3PIB6|ATPD_RHOS1 ATP synthase subunit delta OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpH PE=3 SV=1 22 216 1.0E-15
sp|A8LJR7|ATPD_DINSH ATP synthase subunit delta OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpH PE=3 SV=1 21 216 1.0E-15
sp|Q1MAY9|ATPD_RHIL3 ATP synthase subunit delta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpH PE=3 SV=1 22 216 1.0E-15
sp|Q7CWL8|ATPD_AGRFC ATP synthase subunit delta OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpH PE=3 SV=3 22 216 1.0E-15
sp|Q2K3G7|ATPD_RHIEC ATP synthase subunit delta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=atpH PE=3 SV=2 22 216 1.0E-15
sp|B6IPC9|ATPD_RHOCS ATP synthase subunit delta OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=atpH PE=3 SV=1 12 211 2.0E-15
sp|B1YMR7|ATPD_EXIS2 ATP synthase subunit delta OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=atpH PE=3 SV=1 24 210 3.0E-15
sp|Q8YJ38|ATPD_BRUME ATP synthase subunit delta OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpH PE=3 SV=1 22 210 3.0E-15
sp|C0RF53|ATPD_BRUMB ATP synthase subunit delta OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpH PE=3 SV=1 22 210 3.0E-15
sp|B9JTR5|ATPD_AGRVS ATP synthase subunit delta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpH PE=3 SV=1 22 216 3.0E-15
sp|B3PQ71|ATPD_RHIE6 ATP synthase subunit delta OS=Rhizobium etli (strain CIAT 652) GN=atpH PE=3 SV=2 22 216 6.0E-15
sp|C3M9S4|ATPD_RHISN ATP synthase subunit delta OS=Rhizobium sp. (strain NGR234) GN=atpH PE=3 SV=1 22 216 6.0E-15
sp|Q1AVH6|ATPD_RUBXD ATP synthase subunit delta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=atpH PE=3 SV=1 22 214 1.0E-14
sp|P72244|ATPD_RHOCA ATP synthase subunit delta OS=Rhodobacter capsulatus GN=atpH PE=1 SV=4 22 216 1.0E-14
sp|A7IH28|ATPD_XANP2 ATP synthase subunit delta OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpH PE=3 SV=1 15 213 1.0E-14
sp|Q9A2V6|ATPD_CAUCR ATP synthase subunit delta OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpH PE=3 SV=1 27 217 3.0E-14
sp|B8H5I3|ATPD_CAUCN ATP synthase subunit delta OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=atpH PE=3 SV=2 27 217 3.0E-14
sp|B8JCV3|ATPD_ANAD2 ATP synthase subunit delta OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpH PE=3 SV=1 23 216 5.0E-14
sp|A4WUN0|ATPD_RHOS5 ATP synthase subunit delta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpH PE=3 SV=1 22 216 5.0E-14
sp|B4RD44|ATPD_PHEZH ATP synthase subunit delta OS=Phenylobacterium zucineum (strain HLK1) GN=atpH PE=3 SV=1 22 217 6.0E-14
sp|Q1GEU5|ATPD_RUEST ATP synthase subunit delta OS=Ruegeria sp. (strain TM1040) GN=atpH PE=3 SV=2 24 216 6.0E-14
sp|B0T339|ATPD_CAUSK ATP synthase subunit delta OS=Caulobacter sp. (strain K31) GN=atpH PE=3 SV=2 27 217 7.0E-14
sp|Q162S6|ATPD_ROSDO ATP synthase subunit delta OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpH PE=3 SV=1 21 216 8.0E-14
sp|B9L1H2|ATPD_THERP ATP synthase subunit delta OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=atpH PE=3 SV=1 20 212 8.0E-14
sp|Q0A4M5|ATPD_ALKEH ATP synthase subunit delta OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=atpH PE=3 SV=1 22 214 9.0E-14
sp|Q11DD8|ATPD_CHESB ATP synthase subunit delta OS=Chelativorans sp. (strain BNC1) GN=atpH PE=3 SV=2 22 213 2.0E-13
sp|A8YUJ8|ATPD_LACH4 ATP synthase subunit delta OS=Lactobacillus helveticus (strain DPC 4571) GN=atpH PE=3 SV=1 24 210 2.0E-13
sp|Q9RGY4|ATPD_LACAC ATP synthase subunit delta OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=atpH PE=2 SV=1 24 210 4.0E-13
sp|B4UKF3|ATPD_ANASK ATP synthase subunit delta OS=Anaeromyxobacter sp. (strain K) GN=atpH PE=3 SV=1 23 216 8.0E-13
sp|Q2VZM9|ATPD_MAGSA ATP synthase subunit delta OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpH PE=3 SV=1 24 210 8.0E-13
sp|A7HIY0|ATPD_ANADF ATP synthase subunit delta OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpH PE=3 SV=1 23 216 1.0E-12
sp|A5FL33|ATPD_FLAJ1 ATP synthase subunit delta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=atpH PE=3 SV=1 27 207 2.0E-12
sp|Q74K18|ATPD_LACJO ATP synthase subunit delta OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=atpH PE=3 SV=1 24 210 2.0E-12
sp|Q5LNN8|ATPD_RUEPO ATP synthase subunit delta OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpH PE=3 SV=1 24 216 2.0E-12
sp|C6BSP9|ATPD_DESAD ATP synthase subunit delta OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=atpH PE=3 SV=1 24 218 3.0E-12
sp|B8EQP8|ATPD_METSB ATP synthase subunit delta OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=atpH PE=3 SV=1 22 213 3.0E-12
sp|Q2IHQ8|ATPD_ANADE ATP synthase subunit delta OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpH PE=3 SV=2 23 216 3.0E-12
sp|B9LZ87|ATPD_GEODF ATP synthase subunit delta OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpH PE=3 SV=1 20 216 4.0E-12
sp|A1B8N7|ATPD_PARDP ATP synthase subunit delta OS=Paracoccus denitrificans (strain Pd 1222) GN=atpH PE=1 SV=2 24 216 4.0E-12
sp|A6TK62|ATPD_ALKMQ ATP synthase subunit delta OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpH PE=3 SV=1 21 218 4.0E-12
sp|Q42687|ATPD_CHLRE ATP synthase delta chain, chloroplastic OS=Chlamydomonas reinhardtii GN=ATPD PE=1 SV=1 4 212 6.0E-12
sp|Q2LQZ8|ATPD_SYNAS ATP synthase subunit delta OS=Syntrophus aciditrophicus (strain SB) GN=atpH PE=3 SV=1 22 218 6.0E-12
sp|Q042L2|ATPD_LACGA ATP synthase subunit delta OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=atpH PE=3 SV=1 24 210 8.0E-12
sp|Q313V7|ATPD_DESAG ATP synthase subunit delta OS=Desulfovibrio alaskensis (strain G20) GN=atpH PE=3 SV=1 25 216 8.0E-12
sp|Q2YCA6|ATPD_NITMU ATP synthase subunit delta OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=atpH PE=3 SV=1 24 207 1.0E-11
sp|A5FZ51|ATPD_ACICJ ATP synthase subunit delta OS=Acidiphilium cryptum (strain JF-5) GN=atpH PE=3 SV=1 22 215 1.0E-11
sp|A1UR46|ATPD_BARBK ATP synthase subunit delta OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpH PE=3 SV=1 24 218 1.0E-11
sp|B2VCA7|ATPD_ERWT9 ATP synthase subunit delta OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=atpH PE=3 SV=1 102 215 2.0E-11
sp|Q0BQE5|ATPD_GRABC ATP synthase subunit delta OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpH PE=3 SV=1 20 215 2.0E-11
sp|A7N6Q7|ATPD2_VIBCB ATP synthase subunit delta 2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=atpH2 PE=3 SV=1 102 210 3.0E-11
sp|Q3A943|ATPD_CARHZ ATP synthase subunit delta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpH PE=3 SV=1 23 214 3.0E-11
sp|C5BF37|ATPD_EDWI9 ATP synthase subunit delta OS=Edwardsiella ictaluri (strain 93-146) GN=atpH PE=3 SV=1 24 215 3.0E-11
sp|B2ICI8|ATPD_BEII9 ATP synthase subunit delta OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=atpH PE=3 SV=1 22 213 3.0E-11
sp|Q89B42|ATPD_BUCBP ATP synthase subunit delta OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=atpH PE=3 SV=1 110 215 4.0E-11
sp|Q6MGM4|ATPD_BDEBA ATP synthase subunit delta OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpH PE=3 SV=1 22 211 4.0E-11
sp|C4K906|ATPD_HAMD5 ATP synthase subunit delta OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=atpH PE=3 SV=1 102 214 6.0E-11
sp|B7VSU4|ATPD2_VIBTL ATP synthase subunit delta 2 OS=Vibrio tasmaniensis (strain LGP32) GN=atpH2 PE=3 SV=1 110 210 7.0E-11
sp|C6E9F4|ATPD_GEOSM ATP synthase subunit delta OS=Geobacter sp. (strain M21) GN=atpH PE=3 SV=1 20 216 8.0E-11
sp|B0UE42|ATPD_METS4 ATP synthase subunit delta OS=Methylobacterium sp. (strain 4-46) GN=atpH PE=3 SV=1 24 213 8.0E-11
sp|A4WGF2|ATPD_ENT38 ATP synthase subunit delta OS=Enterobacter sp. (strain 638) GN=atpH PE=3 SV=1 109 215 9.0E-11
sp|C4KYS6|ATPD_EXISA ATP synthase subunit delta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpH PE=3 SV=1 22 210 9.0E-11
sp|C0Z779|ATPD_BREBN ATP synthase subunit delta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpH PE=3 SV=1 21 217 1.0E-10
sp|Q7MGH7|ATPD_VIBVY ATP synthase subunit delta OS=Vibrio vulnificus (strain YJ016) GN=atpH PE=3 SV=2 22 215 1.0E-10
sp|Q8DDH1|ATPD_VIBVU ATP synthase subunit delta OS=Vibrio vulnificus (strain CMCP6) GN=atpH PE=3 SV=1 22 215 1.0E-10
sp|A8HS18|ATPD_AZOC5 ATP synthase subunit delta OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpH PE=3 SV=1 22 213 2.0E-10
sp|B1JRM9|ATPD_YERPY ATP synthase subunit delta OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q663Q5|ATPD_YERPS ATP synthase subunit delta OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|A4TSJ0|ATPD_YERPP ATP synthase subunit delta OS=Yersinia pestis (strain Pestoides F) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q1CCH2|ATPD_YERPN ATP synthase subunit delta OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|A9R5U2|ATPD_YERPG ATP synthase subunit delta OS=Yersinia pestis bv. Antiqua (strain Angola) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q7CFM5|ATPD_YERPE ATP synthase subunit delta OS=Yersinia pestis GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|B2K844|ATPD_YERPB ATP synthase subunit delta OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q1C092|ATPD_YERPA ATP synthase subunit delta OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|A7FPE3|ATPD_YERP3 ATP synthase subunit delta OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q329S4|ATPD_SHIDS ATP synthase subunit delta OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q7NA91|ATPD_PHOLL ATP synthase subunit delta OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=atpH PE=3 SV=1 22 215 2.0E-10
sp|A1JTD0|ATPD_YERE8 ATP synthase subunit delta OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|A9MJR6|ATPD_SALAR ATP synthase subunit delta OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q6CYJ2|ATPD_PECAS ATP synthase subunit delta OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=atpH PE=3 SV=1 102 215 2.0E-10
sp|Q112Z5|ATPD_TRIEI ATP synthase subunit delta OS=Trichodesmium erythraeum (strain IMS101) GN=atpH PE=3 SV=1 21 210 2.0E-10
sp|A7MMX2|ATPD_CROS8 ATP synthase subunit delta OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=atpH PE=3 SV=1 109 215 3.0E-10
sp|A6H2D8|ATPD_FLAPJ ATP synthase subunit delta OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=atpH PE=3 SV=1 27 207 3.0E-10
sp|B3PIT0|ATPD_CELJU ATP synthase subunit delta OS=Cellvibrio japonicus (strain Ueda107) GN=atpH PE=3 SV=1 102 210 3.0E-10
sp|P05438|ATPD_RHORU ATP synthase subunit delta OS=Rhodospirillum rubrum GN=atpH PE=3 SV=2 22 210 3.0E-10
sp|Q2RV21|ATPD_RHORT ATP synthase subunit delta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpH PE=3 SV=1 22 210 3.0E-10
sp|P22479|ATPD_BACPE ATP synthase subunit delta OS=Bacillus pseudofirmus (strain OF4) GN=atpH PE=3 SV=2 23 210 3.0E-10
sp|Q7CPE5|ATPD_SALTY ATP synthase subunit delta OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|Q8XFM9|ATPD_SALTI ATP synthase subunit delta OS=Salmonella typhi GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B4TN34|ATPD_SALSV ATP synthase subunit delta OS=Salmonella schwarzengrund (strain CVM19633) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B5BIN9|ATPD_SALPK ATP synthase subunit delta OS=Salmonella paratyphi A (strain AKU_12601) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|C0Q2N5|ATPD_SALPC ATP synthase subunit delta OS=Salmonella paratyphi C (strain RKS4594) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|A9MXA9|ATPD_SALPB ATP synthase subunit delta OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|Q5PKW9|ATPD_SALPA ATP synthase subunit delta OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B4SYD4|ATPD_SALNS ATP synthase subunit delta OS=Salmonella newport (strain SL254) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B4TAX5|ATPD_SALHS ATP synthase subunit delta OS=Salmonella heidelberg (strain SL476) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B5RFW0|ATPD_SALG2 ATP synthase subunit delta OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B5QUS7|ATPD_SALEP ATP synthase subunit delta OS=Salmonella enteritidis PT4 (strain P125109) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B5FN36|ATPD_SALDC ATP synthase subunit delta OS=Salmonella dublin (strain CT_02021853) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|Q57HX6|ATPD_SALCH ATP synthase subunit delta OS=Salmonella choleraesuis (strain SC-B67) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B5EYZ9|ATPD_SALA4 ATP synthase subunit delta OS=Salmonella agona (strain SL483) GN=atpH PE=3 SV=1 102 215 3.0E-10
sp|B8IN04|ATPD_METNO ATP synthase subunit delta OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpH PE=3 SV=1 24 213 3.0E-10
sp|Q04G23|ATPD_OENOB ATP synthase subunit delta OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=atpH PE=3 SV=1 46 218 3.0E-10
sp|Q3SF63|ATPD_THIDA ATP synthase subunit delta OS=Thiobacillus denitrificans (strain ATCC 25259) GN=atpH PE=3 SV=1 22 215 4.0E-10
sp|C6DJG9|ATPD_PECCP ATP synthase subunit delta OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=atpH PE=3 SV=1 102 215 5.0E-10
sp|A5G9D5|ATPD_GEOUR ATP synthase subunit delta OS=Geobacter uraniireducens (strain Rf4) GN=atpH PE=3 SV=1 20 216 6.0E-10
sp|A8ACP0|ATPD_CITK8 ATP synthase subunit delta OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=atpH PE=3 SV=1 102 215 6.0E-10
sp|Q3YVN9|ATPD_SHISS ATP synthase subunit delta OS=Shigella sonnei (strain Ss046) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|Q0SYU1|ATPD_SHIF8 ATP synthase subunit delta OS=Shigella flexneri serotype 5b (strain 8401) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|Q31UN5|ATPD_SHIBS ATP synthase subunit delta OS=Shigella boydii serotype 4 (strain Sb227) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B2TUP0|ATPD_SHIB3 ATP synthase subunit delta OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7LK80|ATPD_ESCF3 ATP synthase subunit delta OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|Q1R4J8|ATPD_ECOUT ATP synthase subunit delta OS=Escherichia coli (strain UTI89 / UPEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B1LL62|ATPD_ECOSM ATP synthase subunit delta OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B6I3X2|ATPD_ECOSE ATP synthase subunit delta OS=Escherichia coli (strain SE11) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7NF51|ATPD_ECOLU ATP synthase subunit delta OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|P0ABA4|ATPD_ECOLI ATP synthase subunit delta OS=Escherichia coli (strain K12) GN=atpH PE=1 SV=1 102 215 7.0E-10
sp|B1IX03|ATPD_ECOLC ATP synthase subunit delta OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|Q0TAX4|ATPD_ECOL5 ATP synthase subunit delta OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|A8A6J8|ATPD_ECOHS ATP synthase subunit delta OS=Escherichia coli O9:H4 (strain HS) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B1X9W3|ATPD_ECODH ATP synthase subunit delta OS=Escherichia coli (strain K12 / DH10B) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|C4ZZ13|ATPD_ECOBW ATP synthase subunit delta OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7M591|ATPD_ECO8A ATP synthase subunit delta OS=Escherichia coli O8 (strain IAI1) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7NR37|ATPD_ECO7I ATP synthase subunit delta OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B5YXD9|ATPD_ECO5E ATP synthase subunit delta OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|P0ABA5|ATPD_ECO57 ATP synthase subunit delta OS=Escherichia coli O157:H7 GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7L885|ATPD_ECO55 ATP synthase subunit delta OS=Escherichia coli (strain 55989 / EAEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7MGF5|ATPD_ECO45 ATP synthase subunit delta OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|B7UMK0|ATPD_ECO27 ATP synthase subunit delta OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|A7ZTU7|ATPD_ECO24 ATP synthase subunit delta OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=atpH PE=3 SV=1 102 215 7.0E-10
sp|A1WZT4|ATPD_HALHL ATP synthase subunit delta OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpH PE=3 SV=1 22 214 8.0E-10
sp|B3R7L8|ATPD_CUPTR ATP synthase subunit delta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=atpH PE=3 SV=1 24 214 8.0E-10
sp|C4LDW3|ATPD_TOLAT ATP synthase subunit delta OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=atpH PE=3 SV=1 102 215 8.0E-10
sp|Q83PJ9|ATPD_SHIFL ATP synthase subunit delta OS=Shigella flexneri GN=atpH PE=3 SV=1 102 215 9.0E-10
sp|Q8FBT0|ATPD_ECOL6 ATP synthase subunit delta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=atpH PE=3 SV=1 102 215 9.0E-10
sp|B7N2H4|ATPD_ECO81 ATP synthase subunit delta OS=Escherichia coli O81 (strain ED1a) GN=atpH PE=3 SV=1 102 215 9.0E-10
sp|Q3J6M8|ATPD_NITOC ATP synthase subunit delta OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpH PE=3 SV=1 24 210 1.0E-09
sp|Q5NQZ2|ATPD_ZYMMO ATP synthase subunit delta OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpH PE=3 SV=1 22 210 1.0E-09
sp|A8G7M5|ATPD_SERP5 ATP synthase subunit delta OS=Serratia proteamaculans (strain 568) GN=atpH PE=3 SV=1 24 215 1.0E-09
sp|B5EFJ0|ATPD_GEOBB ATP synthase subunit delta OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpH PE=3 SV=1 20 216 1.0E-09
sp|Q0K5M4|ATPD_CUPNH ATP synthase subunit delta OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=atpH PE=3 SV=1 24 210 1.0E-09
sp|B8DRC9|ATPD_DESVM ATP synthase subunit delta OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=atpH PE=3 SV=1 24 216 2.0E-09
sp|B1HM53|ATPD_LYSSC ATP synthase subunit delta OS=Lysinibacillus sphaericus (strain C3-41) GN=atpH PE=3 SV=1 22 210 2.0E-09
sp|Q38WK2|ATPD_LACSS ATP synthase subunit delta OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=atpH PE=3 SV=1 23 214 2.0E-09
sp|C5BKJ8|ATPD_TERTT ATP synthase subunit delta OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=atpH PE=3 SV=1 24 210 2.0E-09
sp|B7VMZ9|ATPD1_VIBTL ATP synthase subunit delta 1 OS=Vibrio tasmaniensis (strain LGP32) GN=atpH1 PE=3 SV=1 22 215 2.0E-09
sp|B1ZEF0|ATPD_METPB ATP synthase subunit delta OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpH PE=3 SV=1 24 213 2.0E-09
sp|Q2NQ89|ATPD_SODGM ATP synthase subunit delta OS=Sodalis glossinidius (strain morsitans) GN=atpH PE=3 SV=1 102 215 2.0E-09
sp|Q4FP35|ATPD_PELUB ATP synthase subunit delta OS=Pelagibacter ubique (strain HTCC1062) GN=atpH PE=3 SV=1 27 212 4.0E-09
sp|Q0ZS22|ATPD_CLOPD ATP synthase subunit delta, sodium ion specific OS=Clostridium paradoxum GN=atpH PE=1 SV=1 21 218 4.0E-09
sp|A9W2R4|ATPD_METEP ATP synthase subunit delta OS=Methylobacterium extorquens (strain PA1) GN=atpH PE=3 SV=2 24 213 4.0E-09
sp|B5XZM1|ATPD_KLEP3 ATP synthase subunit delta OS=Klebsiella pneumoniae (strain 342) GN=atpH PE=3 SV=1 102 215 5.0E-09
sp|Q494C6|ATPD_BLOPB ATP synthase subunit delta OS=Blochmannia pennsylvanicus (strain BPEN) GN=atpH PE=3 SV=1 100 215 5.0E-09
sp|A9H9A1|ATPD_GLUDA ATP synthase subunit delta OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpH PE=3 SV=1 102 215 5.0E-09
sp|B1LVH2|ATPD_METRJ ATP synthase subunit delta OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=atpH PE=3 SV=1 22 213 5.0E-09
sp|Q87KA5|ATPD_VIBPA ATP synthase subunit delta OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=atpH PE=3 SV=1 109 215 5.0E-09
sp|A6TG39|ATPD_KLEP7 ATP synthase subunit delta OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=atpH PE=3 SV=1 102 215 5.0E-09
sp|A8MJW2|ATPD_ALKOO ATP synthase subunit delta OS=Alkaliphilus oremlandii (strain OhILAs) GN=atpH PE=3 SV=1 21 210 6.0E-09
sp|A2C4J6|ATPD_PROM1 ATP synthase subunit delta OS=Prochlorococcus marinus (strain NATL1A) GN=atpH PE=3 SV=1 24 210 6.0E-09
sp|Q39Q53|ATPD_GEOMG ATP synthase subunit delta OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpH PE=3 SV=1 21 216 6.0E-09
sp|Q1QSC7|ATPD_CHRSD ATP synthase subunit delta OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpH PE=3 SV=1 22 214 7.0E-09
sp|A5CYE5|ATPD_PELTS ATP synthase subunit delta OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpH PE=3 SV=1 23 210 8.0E-09
sp|B0TQF7|ATPD_SHEHH ATP synthase subunit delta OS=Shewanella halifaxensis (strain HAW-EB4) GN=atpH PE=3 SV=1 102 215 9.0E-09
sp|P12987|ATPD_VIBAL ATP synthase subunit delta OS=Vibrio alginolyticus GN=atpH PE=3 SV=1 109 215 1.0E-08
sp|Q5HC94|ATPD_EHRRW ATP synthase subunit delta OS=Ehrlichia ruminantium (strain Welgevonden) GN=atpH PE=3 SV=1 24 210 1.0E-08
sp|Q5FF65|ATPD_EHRRG ATP synthase subunit delta OS=Ehrlichia ruminantium (strain Gardel) GN=atpH PE=3 SV=1 24 210 1.0E-08
sp|B3EA04|ATPD_GEOLS ATP synthase subunit delta OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpH PE=3 SV=1 22 216 1.0E-08
sp|Q46J56|ATPD_PROMT ATP synthase subunit delta OS=Prochlorococcus marinus (strain NATL2A) GN=atpH PE=3 SV=1 24 210 1.0E-08
sp|B4F0E4|ATPD_PROMH ATP synthase subunit delta OS=Proteus mirabilis (strain HI4320) GN=atpH PE=3 SV=1 102 215 1.0E-08
sp|Q03QY5|ATPD_LACBA ATP synthase subunit delta OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=atpH PE=3 SV=1 22 210 1.0E-08
sp|B8CVU8|ATPD_SHEPW ATP synthase subunit delta OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=atpH PE=3 SV=1 22 215 1.0E-08
sp|Q6GEW9|ATPD_STAAR ATP synthase subunit delta OS=Staphylococcus aureus (strain MRSA252) GN=atpH PE=3 SV=1 24 210 1.0E-08
sp|B7KUA5|ATPD_METC4 ATP synthase subunit delta OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpH PE=3 SV=1 24 213 1.0E-08
sp|Q11YP2|ATPD_CYTH3 ATP synthase subunit delta OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpH PE=3 SV=1 24 218 1.0E-08
sp|Q2GHX4|ATPD_EHRCR ATP synthase subunit delta OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|P63659|ATPD_STAAW ATP synthase subunit delta OS=Staphylococcus aureus (strain MW2) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|Q6G7K4|ATPD_STAAS ATP synthase subunit delta OS=Staphylococcus aureus (strain MSSA476) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|P99109|ATPD_STAAN ATP synthase subunit delta OS=Staphylococcus aureus (strain N315) GN=atpH PE=1 SV=1 24 210 2.0E-08
sp|P63658|ATPD_STAAM ATP synthase subunit delta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|A5IUQ1|ATPD_STAA9 ATP synthase subunit delta OS=Staphylococcus aureus (strain JH9) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|A6U3J1|ATPD_STAA2 ATP synthase subunit delta OS=Staphylococcus aureus (strain JH1) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|A7X4U8|ATPD_STAA1 ATP synthase subunit delta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|A8YY73|ATPD_STAAT ATP synthase subunit delta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|A6QIV0|ATPD_STAAE ATP synthase subunit delta OS=Staphylococcus aureus (strain Newman) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|Q5HE94|ATPD_STAAC ATP synthase subunit delta OS=Staphylococcus aureus (strain COL) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|Q2FWE7|ATPD_STAA8 ATP synthase subunit delta OS=Staphylococcus aureus (strain NCTC 8325) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|Q2FF21|ATPD_STAA3 ATP synthase subunit delta OS=Staphylococcus aureus (strain USA300) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|P26680|ATPD_ENTHA ATP synthase subunit delta OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=atpH PE=3 SV=1 23 212 2.0E-08
sp|Q6FYM0|ATPD_BARQU ATP synthase subunit delta OS=Bartonella quintana (strain Toulouse) GN=atpH PE=3 SV=1 24 218 2.0E-08
sp|B2T7K3|ATPD_BURPP ATP synthase subunit delta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=atpH PE=3 SV=1 24 214 2.0E-08
sp|P35010|ATPD_GALSU ATP synthase subunit delta, chloroplastic OS=Galdieria sulphuraria GN=atpD PE=3 SV=1 24 207 2.0E-08
sp|A8G1W8|ATPD_SHESH ATP synthase subunit delta OS=Shewanella sediminis (strain HAW-EB3) GN=atpH PE=3 SV=1 102 215 2.0E-08
sp|Q7V5S6|ATPD_PROMM ATP synthase subunit delta OS=Prochlorococcus marinus (strain MIT 9313) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|A2C6X4|ATPD_PROM3 ATP synthase subunit delta OS=Prochlorococcus marinus (strain MIT 9303) GN=atpH PE=3 SV=1 24 210 2.0E-08
sp|Q180W9|ATPD_PEPD6 ATP synthase subunit delta OS=Peptoclostridium difficile (strain 630) GN=atpH PE=3 SV=1 22 210 3.0E-08
sp|Q2YUJ8|ATPD_STAAB ATP synthase subunit delta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpH PE=3 SV=1 24 210 4.0E-08
sp|A1W2T4|ATPD_ACISJ ATP synthase subunit delta OS=Acidovorax sp. (strain JS42) GN=atpH PE=3 SV=1 22 210 4.0E-08
sp|B9MBA0|ATPD_ACIET ATP synthase subunit delta OS=Acidovorax ebreus (strain TPSY) GN=atpH PE=3 SV=1 22 210 4.0E-08
sp|Q2S6N8|ATPD_HAHCH ATP synthase subunit delta OS=Hahella chejuensis (strain KCTC 2396) GN=atpH PE=3 SV=1 104 210 4.0E-08
sp|A7N0Y4|ATPD1_VIBCB ATP synthase subunit delta 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=atpH1 PE=3 SV=1 22 215 4.0E-08
sp|B2UGV2|ATPD_RALPJ ATP synthase subunit delta OS=Ralstonia pickettii (strain 12J) GN=atpH PE=3 SV=1 49 214 4.0E-08
sp|C0Q981|ATPD_DESAH ATP synthase subunit delta OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=atpH PE=3 SV=1 23 216 5.0E-08
sp|C4XI07|ATPD_DESMR ATP synthase subunit delta OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=atpH PE=3 SV=1 24 216 5.0E-08
sp|B5YI21|ATPD_THEYD ATP synthase subunit delta OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=atpH PE=3 SV=1 18 212 5.0E-08
sp|Q15MU1|ATPD_PSEA6 ATP synthase subunit delta OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=atpH PE=3 SV=1 22 215 5.0E-08
sp|Q74GY3|ATPD_GEOSL ATP synthase subunit delta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpH PE=3 SV=1 21 216 5.0E-08
sp|A8HAG6|ATPD_SHEPA ATP synthase subunit delta OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=atpH PE=3 SV=1 102 215 6.0E-08
sp|Q0AKV7|ATPD_MARMM ATP synthase subunit delta OS=Maricaulis maris (strain MCS10) GN=atpH PE=3 SV=1 27 217 6.0E-08
sp|Q1GAW8|ATPD_LACDA ATP synthase subunit delta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=atpH PE=3 SV=1 25 210 6.0E-08
sp|Q6LKZ9|ATPD2_PHOPR ATP synthase subunit delta 2 OS=Photobacterium profundum GN=atpH2 PE=3 SV=1 104 215 7.0E-08
sp|Q07VU1|ATPD_SHEFN ATP synthase subunit delta OS=Shewanella frigidimarina (strain NCIMB 400) GN=atpH PE=3 SV=1 22 215 7.0E-08
sp|Q5QZI3|ATPD_IDILO ATP synthase subunit delta OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=atpH PE=3 SV=1 22 215 7.0E-08
sp|Q831A2|ATPD_ENTFA ATP synthase subunit delta OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpH PE=3 SV=1 24 210 8.0E-08
sp|Q31DL7|ATPD_THICR ATP synthase subunit delta OS=Thiomicrospira crunogena (strain XCL-2) GN=atpH PE=3 SV=1 24 216 8.0E-08
sp|Q7VA62|ATPD_PROMA ATP synthase subunit delta OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=atpH PE=3 SV=1 61 210 9.0E-08
sp|Q82XQ1|ATPD_NITEU ATP synthase subunit delta OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=atpH PE=3 SV=1 21 207 9.0E-08
sp|Q4L7Y7|ATPD_STAHJ ATP synthase subunit delta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpH PE=3 SV=1 24 204 9.0E-08
sp|Q3IK47|ATPD_PSEHT ATP synthase subunit delta OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=atpH PE=3 SV=1 102 215 1.0E-07
sp|Q04BA6|ATPD_LACDB ATP synthase subunit delta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=atpH PE=3 SV=1 25 214 1.0E-07
sp|Q46VX7|ATPD_CUPPJ ATP synthase subunit delta OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=atpH PE=3 SV=1 49 210 1.0E-07
sp|C1D5G5|ATPD_LARHH ATP synthase subunit delta OS=Laribacter hongkongensis (strain HLHK9) GN=atpH PE=3 SV=1 24 210 1.0E-07
sp|P57121|ATPD_BUCAI ATP synthase subunit delta OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=atpH PE=3 SV=1 20 210 1.0E-07
sp|P43717|ATPD_HAEIN ATP synthase subunit delta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atpH PE=3 SV=1 102 215 1.0E-07
sp|A5UGZ2|ATPD_HAEIG ATP synthase subunit delta OS=Haemophilus influenzae (strain PittGG) GN=atpH PE=3 SV=1 102 215 1.0E-07
sp|Q4QN61|ATPD_HAEI8 ATP synthase subunit delta OS=Haemophilus influenzae (strain 86-028NP) GN=atpH PE=3 SV=1 102 215 1.0E-07
sp|B8GRC1|ATPD_THISH ATP synthase subunit delta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=atpH PE=3 SV=1 22 210 1.0E-07
sp|A1T0Z2|ATPD_PSYIN ATP synthase subunit delta OS=Psychromonas ingrahamii (strain 37) GN=atpH PE=3 SV=1 46 215 1.0E-07
sp|Q5KUJ0|ATPD_GEOKA ATP synthase subunit delta OS=Geobacillus kaustophilus (strain HTA426) GN=atpH PE=3 SV=1 24 212 2.0E-07
sp|A5UA08|ATPD_HAEIE ATP synthase subunit delta OS=Haemophilus influenzae (strain PittEE) GN=atpH PE=3 SV=1 102 215 2.0E-07
sp|B5FCZ4|ATPD_VIBFM ATP synthase subunit delta OS=Vibrio fischeri (strain MJ11) GN=atpH PE=3 SV=2 22 215 3.0E-07
sp|Q0C0Z7|ATPD_HYPNA ATP synthase subunit delta OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpH PE=3 SV=1 22 215 3.0E-07
sp|Q49Z53|ATPD_STAS1 ATP synthase subunit delta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=atpH PE=3 SV=1 24 210 3.0E-07
sp|Q65Q04|ATPD_MANSM ATP synthase subunit delta OS=Mannheimia succiniciproducens (strain MBEL55E) GN=atpH PE=3 SV=2 22 215 3.0E-07
sp|Q1LHK7|ATPD_CUPMC ATP synthase subunit delta OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=atpH PE=3 SV=1 24 210 3.0E-07
sp|B8FGT7|ATPD_DESAA ATP synthase subunit delta OS=Desulfatibacillum alkenivorans (strain AK-01) GN=atpH PE=3 SV=1 50 217 4.0E-07
sp|A1ALL4|ATPD_PELPD ATP synthase subunit delta OS=Pelobacter propionicus (strain DSM 2379) GN=atpH1 PE=3 SV=1 43 216 4.0E-07
sp|Q8XU73|ATPD_RALSO ATP synthase subunit delta OS=Ralstonia solanacearum (strain GMI1000) GN=atpH PE=3 SV=1 49 214 4.0E-07
sp|A9GHR9|ATPD_SORC5 ATP synthase subunit delta OS=Sorangium cellulosum (strain So ce56) GN=atpH PE=3 SV=1 23 212 5.0E-07
sp|B8D6S4|ATPD_BUCAT ATP synthase subunit delta OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=atpH PE=3 SV=1 20 210 5.0E-07
sp|B8D8H0|ATPD_BUCA5 ATP synthase subunit delta OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=atpH PE=3 SV=1 20 210 5.0E-07
sp|B9DME7|ATPD_STACT ATP synthase subunit delta OS=Staphylococcus carnosus (strain TM300) GN=atpH PE=3 SV=1 24 210 5.0E-07
sp|Q5FRC8|ATPD_GLUOX ATP synthase subunit delta OS=Gluconobacter oxydans (strain 621H) GN=atpH PE=3 SV=1 9 215 5.0E-07
sp|Q39ZT8|ATPD2_PELCD ATP synthase subunit delta 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpH2 PE=3 SV=1 21 210 5.0E-07
sp|A9IYX2|ATPD_BART1 ATP synthase subunit delta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpH PE=3 SV=1 24 200 5.0E-07
sp|Q6MAK4|ATPD_PARUW ATP synthase subunit delta OS=Protochlamydia amoebophila (strain UWE25) GN=atpH PE=3 SV=1 21 210 5.0E-07
sp|P42008|ATPD_GEOSE ATP synthase subunit delta OS=Geobacillus stearothermophilus GN=atpH PE=3 SV=1 24 210 5.0E-07
sp|A1VFJ2|ATPD_DESVV ATP synthase subunit delta OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=atpH PE=3 SV=1 24 216 5.0E-07
sp|Q72E01|ATPD_DESVH ATP synthase subunit delta OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=atpH PE=3 SV=1 24 216 5.0E-07
sp|Q5GSX0|ATPD_WOLTR ATP synthase subunit delta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpH PE=3 SV=1 102 210 6.0E-07
sp|B7GTZ0|ATPD_BIFLS ATP synthase subunit delta OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=atpH PE=3 SV=1 104 215 6.0E-07
sp|B1MW88|ATPD_LEUCK ATP synthase subunit delta OS=Leuconostoc citreum (strain KM20) GN=atpH PE=3 SV=1 24 210 6.0E-07
sp|Q8G7B0|ATPD_BIFLO ATP synthase subunit delta OS=Bifidobacterium longum (strain NCC 2705) GN=atpH PE=3 SV=1 104 215 6.0E-07
sp|B3DTV3|ATPD_BIFLD ATP synthase subunit delta OS=Bifidobacterium longum (strain DJO10A) GN=atpH PE=3 SV=1 104 215 6.0E-07
sp|Q9CKW3|ATPD_PASMU ATP synthase subunit delta OS=Pasteurella multocida (strain Pm70) GN=atpH PE=3 SV=1 102 215 7.0E-07
sp|B6EHU0|ATPD_ALISL ATP synthase subunit delta OS=Aliivibrio salmonicida (strain LFI1238) GN=atpH PE=3 SV=1 22 215 8.0E-07
sp|A5GV73|ATPD_SYNR3 ATP synthase subunit delta OS=Synechococcus sp. (strain RCC307) GN=atpH PE=3 SV=1 45 210 8.0E-07
sp|A0T0F0|ATPD_PHATC ATP synthase subunit delta, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=atpD PE=3 SV=1 24 210 1.0E-06
sp|A9BCE0|ATPD_PROM4 ATP synthase subunit delta OS=Prochlorococcus marinus (strain MIT 9211) GN=atpH PE=3 SV=1 110 210 1.0E-06
sp|B8F771|ATPD_HAEPS ATP synthase subunit delta OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=atpH PE=3 SV=1 102 211 1.0E-06
sp|A4VS65|ATPD_PSEU5 ATP synthase subunit delta OS=Pseudomonas stutzeri (strain A1501) GN=atpH PE=3 SV=1 62 210 1.0E-06
sp|Q5M107|ATPD_STRT1 ATP synthase subunit delta OS=Streptococcus thermophilus (strain CNRZ 1066) GN=atpH PE=3 SV=1 99 207 1.0E-06
sp|A1IPX2|ATPD_NEIMA ATP synthase subunit delta OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=atpH PE=3 SV=1 22 210 1.0E-06
sp|A1WF55|ATPD_VEREI ATP synthase subunit delta OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpH PE=3 SV=1 57 210 1.0E-06
sp|Q03LX6|ATPD_STRTD ATP synthase subunit delta OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=atpH PE=3 SV=1 99 207 2.0E-06
sp|Q5M5J4|ATPD_STRT2 ATP synthase subunit delta OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=atpH PE=3 SV=1 99 207 2.0E-06
sp|B3WDL5|ATPD_LACCB ATP synthase subunit delta OS=Lactobacillus casei (strain BL23) GN=atpH PE=3 SV=1 24 210 2.0E-06
sp|Q5E1N4|ATPD_VIBF1 ATP synthase subunit delta OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=atpH PE=3 SV=1 22 215 2.0E-06
sp|Q6AG61|ATPD_LEIXX ATP synthase subunit delta OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=atpH PE=3 SV=1 107 211 2.0E-06
sp|Q03A21|ATPD_LACC3 ATP synthase subunit delta OS=Lactobacillus casei (strain ATCC 334) GN=atpH PE=3 SV=1 24 210 2.0E-06
sp|A1KW14|ATPD_NEIMF ATP synthase subunit delta OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=atpH PE=3 SV=1 22 210 2.0E-06
sp|Q5F4Z3|ATPD_NEIG1 ATP synthase subunit delta OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=atpH PE=3 SV=1 22 210 2.0E-06
sp|Q1Q896|ATPD_PSYCK ATP synthase subunit delta OS=Psychrobacter cryohalolentis (strain K5) GN=atpH PE=3 SV=1 22 210 2.0E-06
sp|Q1MRC0|ATPD_LAWIP ATP synthase subunit delta OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpH PE=3 SV=1 24 216 2.0E-06
sp|A4SUT1|ATPD_POLSQ ATP synthase subunit delta OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=atpH PE=3 SV=1 24 210 2.0E-06
sp|Q13SP9|ATPD_BURXL ATP synthase subunit delta OS=Burkholderia xenovorans (strain LB400) GN=atpH PE=3 SV=1 24 214 2.0E-06
sp|Q7U8W6|ATPD_SYNPX ATP synthase subunit delta OS=Synechococcus sp. (strain WH8102) GN=atpH PE=3 SV=1 110 210 2.0E-06
sp|A0LLG1|ATPD_SYNFM ATP synthase subunit delta OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=atpH PE=3 SV=1 24 216 2.0E-06
sp|Q1WUC9|ATPD_LACS1 ATP synthase subunit delta OS=Lactobacillus salivarius (strain UCC118) GN=atpH PE=3 SV=1 24 214 2.0E-06
sp|B2GAU2|ATPD_LACF3 ATP synthase subunit delta OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=atpH PE=3 SV=1 16 214 2.0E-06
sp|Q9JXP9|ATPD_NEIMB ATP synthase subunit delta OS=Neisseria meningitidis serogroup B (strain MC58) GN=atpH PE=3 SV=1 22 210 3.0E-06
sp|Q3AZM2|ATPD_SYNS9 ATP synthase subunit delta OS=Synechococcus sp. (strain CC9902) GN=atpH PE=3 SV=1 110 210 3.0E-06
sp|A1U7H7|ATPD_MARHV ATP synthase subunit delta OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=atpH PE=3 SV=1 22 210 3.0E-06
sp|Q0HPF8|ATPD_SHESR ATP synthase subunit delta OS=Shewanella sp. (strain MR-7) GN=atpH PE=3 SV=1 102 215 4.0E-06
sp|B4RJF7|ATPD_NEIG2 ATP synthase subunit delta OS=Neisseria gonorrhoeae (strain NCCP11945) GN=atpH PE=3 SV=2 22 210 4.0E-06
sp|A0L2T1|ATPD_SHESA ATP synthase subunit delta OS=Shewanella sp. (strain ANA-3) GN=atpH PE=3 SV=1 102 215 4.0E-06
sp|Q2RFX6|ATPD_MOOTA ATP synthase subunit delta OS=Moorella thermoacetica (strain ATCC 39073) GN=atpH PE=1 SV=1 104 217 4.0E-06
sp|Q1GXM7|ATPD_METFK ATP synthase subunit delta OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=atpH PE=3 SV=1 21 210 4.0E-06
sp|Q0I7R1|ATPD_SYNS3 ATP synthase subunit delta OS=Synechococcus sp. (strain CC9311) GN=atpH PE=3 SV=1 110 210 4.0E-06
sp|B1KQ37|ATPD_SHEWM ATP synthase subunit delta OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=atpH PE=3 SV=1 22 215 5.0E-06
sp|A4ITJ2|ATPD_GEOTN ATP synthase subunit delta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=atpH PE=3 SV=1 24 210 5.0E-06
sp|A9M120|ATPD_NEIM0 ATP synthase subunit delta OS=Neisseria meningitidis serogroup C (strain 053442) GN=atpH PE=3 SV=1 22 210 6.0E-06
sp|A0KQY1|ATPD_AERHH ATP synthase subunit delta OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=atpH PE=3 SV=1 102 215 7.0E-06
sp|Q2KU33|ATPD_BORA1 ATP synthase subunit delta OS=Bordetella avium (strain 197N) GN=atpH PE=3 SV=1 22 214 7.0E-06
sp|A3QJR3|ATPD_SHELP ATP synthase subunit delta OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=atpH PE=3 SV=1 22 215 7.0E-06
sp|C3LSJ2|ATPD_VIBCM ATP synthase subunit delta OS=Vibrio cholerae serotype O1 (strain M66-2) GN=atpH PE=3 SV=1 109 215 7.0E-06
sp|Q9KNH2|ATPD_VIBCH ATP synthase subunit delta OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=atpH PE=3 SV=1 109 215 7.0E-06
sp|A5F476|ATPD_VIBC3 ATP synthase subunit delta OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=atpH PE=3 SV=1 109 215 7.0E-06
sp|A1A3C8|ATPD_BIFAA ATP synthase subunit delta OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=atpH PE=3 SV=1 46 215 7.0E-06
sp|Q3AHK4|ATPD_SYNSC ATP synthase subunit delta OS=Synechococcus sp. (strain CC9605) GN=atpH PE=3 SV=1 110 210 8.0E-06
sp|Q6G1W6|ATPD_BARHE ATP synthase subunit delta OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpH PE=3 SV=1 24 210 9.0E-06
sp|Q65DX1|ATPD_BACLD ATP synthase subunit delta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpH PE=3 SV=1 22 210 1.0E-05
sp|B2A3G5|ATPD_NATTJ ATP synthase subunit delta OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=atpH PE=3 SV=1 24 217 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Yes
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:0019637 organophosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006754 ATP biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0009165 nucleotide biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005261 cation channel activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0016874 ligase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0022857 transmembrane transporter activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0005216 ion channel activity No
GO:0015078 proton transmembrane transporter activity No
GO:0008152 metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0046034 ATP metabolic process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046390 ribose phosphate biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0008324 cation transmembrane transporter activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0015252 proton channel activity No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005215 transporter activity No
GO:0090407 organophosphate biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0015267 channel activity No
GO:0044281 small molecule metabolic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0022803 passive transmembrane transporter activity No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0003824 catalytic activity No
GO:0019438 aromatic compound biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0018130 heterocycle biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|041620
MLLASATRTISATPGLGRRAASAISSKYSKAVFGAALQKSPQILNKVATELTNASNAIKASPEISTLIRNPTLSS
QERLAGLQLLYGKLEGGSGGGGAAKKEGLSEITKNLFEVLSENGRLGEAEEVIQGFQELLAQHKGELTVTVTSAQ
PLPRDMVTRLENALKQSQAAQAAKVLKIENKINPSILGGVIVDFGEKSIDLSVQSRVTKLNNVIQQSV*
Coding >Agabi119p4|041620
ATGCTGCTCGCTTCTGCAACTCGTACTATCTCTGCCACCCCAGGCTTGGGTCGCCGTGCAGCCTCAGCTATCTCT
TCCAAATATTCAAAGGCCGTCTTCGGAGCCGCTCTCCAAAAATCACCTCAAATCCTCAACAAAGTCGCTACAGAA
CTCACAAACGCCTCCAATGCGATCAAAGCCTCTCCAGAAATCAGTACATTGATCAGAAACCCTACTCTTTCTTCT
CAAGAACGTTTGGCTGGACTGCAACTTCTTTACGGGAAACTTGAAGGTGGTAGTGGTGGTGGTGGTGCTGCGAAG
AAGGAGGGTTTGTCGGAAATTACTAAGAATTTGTTTGAAGTTTTGTCGGAGAATGGGAGGTTGGGAGAGGCGGAG
GAGGTTATTCAGGGGTTTCAAGAGTTGTTGGCGCAGCATAAGGGGGAATTGACTGTGACGGTTACTTCTGCTCAA
CCTTTGCCAAGGGATATGGTTACTCGTCTTGAGAATGCGCTTAAACAGTCGCAAGCTGCTCAAGCTGCAAAGGTT
TTGAAGATTGAAAACAAGATCAATCCTTCTATTCTTGGTGGTGTTATTGTCGACTTTGGTGAAAAGTCAATCGAT
TTGAGCGTGCAGTCGCGAGTGACTAAACTCAACAACGTTATACAACAATCGGTTTAA
Transcript >Agabi119p4|041620
ATGCTGCTCGCTTCTGCAACTCGTACTATCTCTGCCACCCCAGGCTTGGGTCGCCGTGCAGCCTCAGCTATCTCT
TCCAAATATTCAAAGGCCGTCTTCGGAGCCGCTCTCCAAAAATCACCTCAAATCCTCAACAAAGTCGCTACAGAA
CTCACAAACGCCTCCAATGCGATCAAAGCCTCTCCAGAAATCAGTACATTGATCAGAAACCCTACTCTTTCTTCT
CAAGAACGTTTGGCTGGACTGCAACTTCTTTACGGGAAACTTGAAGGTGGTAGTGGTGGTGGTGGTGCTGCGAAG
AAGGAGGGTTTGTCGGAAATTACTAAGAATTTGTTTGAAGTTTTGTCGGAGAATGGGAGGTTGGGAGAGGCGGAG
GAGGTTATTCAGGGGTTTCAAGAGTTGTTGGCGCAGCATAAGGGGGAATTGACTGTGACGGTTACTTCTGCTCAA
CCTTTGCCAAGGGATATGGTTACTCGTCTTGAGAATGCGCTTAAACAGTCGCAAGCTGCTCAAGCTGCAAAGGTT
TTGAAGATTGAAAACAAGATCAATCCTTCTATTCTTGGTGGTGTTATTGTCGACTTTGGTGAAAAGTCAATCGAT
TTGAGCGTGCAGTCGCGAGTGACTAAACTCAACAACGTTATACAACAATCGGTTTAA
Gene >Agabi119p4|041620
ATGCTGCTCGCTTCTGCAACTCGTACTATCTCTGCCACCCCAGGCTTGGGTCGCCGTGCAGCCTCAGCTATCTCT
TCCAAATATTCAAAGGCCGTCTTCGGAGCCGCTCTCCAAAAATCACCTCAAATCCTCAACAAAGTCGCTACAGAA
CTCACAAACGCCTCCAATGCGATCAAAGCCTCTCCAGAAATCAGTACATTGATCAGAAACCCTACTCTTTCTTCT
CAAGAACGTTTGGCTGGACTGCAACTTCTTTACGGGAAACTTGAAGGTGGTAGTGGTGGTGGTGGTGCTGCGAAG
AAGGAGGGTTTGTCGGAAATTACTAAGAATTTGTTTGAAGTTTTGTCGGAGAATGGGAGGTTGGGAGAGGCGGAG
GAGGTTATTCAGGGGTTTCAAGAGTTGTTGGCGCAGCATAAGGGGGAATTGACTGTGACGGTTACTTCTGCTCAA
CCTTTGCCAAGGGATATGGTTACTCGTCTTGAGAATGCGCTTAAACAGTCGCAAGCTGCTCAAGCTGCAAAGGTT
TTGAAGATTGAAAACAAGGTGCGTTTCGCGTTTGTGTTTGGTTTTTTTTTATCTTGTCTTCTGAGGGGGCATTCC
TTTGTTTGTTTTTTTATTGGATAGATCAATCCTTCTATTCTTGGTGGTGTTATTGTCGACTTTGGTGAAAAGTCA
ATCGATTTGAGCGTGCAGTCGCGAGTGACTAAACTCAACAACGTTATACAACGTGCGTTTTTCAATATTACTTTG
GCATTTGCTGGCGTGTAATTCTGATGTGTATCTCTAGAATCGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail