Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|041480
Gene name
Locationscaffold_02:640511..641820
Strand-
Gene length (bp)1309
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.5E-19 28 177
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.7E-14 34 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 11 240 2.0E-23
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 5 295 2.0E-22
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 11 328 9.0E-22
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 11 301 1.0E-21
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 11 328 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 11 240 2.0E-23
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 5 295 2.0E-22
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 11 328 9.0E-22
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 11 301 1.0E-21
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 11 328 2.0E-21
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 5 295 2.0E-20
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 11 310 3.0E-20
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 22 335 3.0E-20
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 22 250 4.0E-20
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 25 301 9.0E-20
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 24 303 2.0E-19
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 24 314 6.0E-19
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 22 250 1.0E-18
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 24 321 2.0E-18
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 11 301 2.0E-18
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 4 301 2.0E-18
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 24 253 2.0E-17
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 24 297 5.0E-17
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 22 253 1.0E-16
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 28 325 3.0E-13
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 27 294 9.0E-13
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 28 283 3.0E-12
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 30 246 6.0E-11
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 28 283 9.0E-11
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 29 314 9.0E-11
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 28 246 1.0E-10
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 29 278 2.0E-10
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 17 278 3.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 24 245 9.0E-10
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 24 261 5.0E-09
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 28 278 6.0E-09
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 30 301 9.0E-09
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 30 301 1.0E-08
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 24 261 2.0E-08
sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 30 246 2.0E-08
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 18 172 3.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 9 141 4.0E-08
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 30 246 8.0E-08
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 25 151 2.0E-07
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 28 246 3.0E-07
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 18 151 7.0E-07
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 17 275 7.0E-07
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 30 246 1.0E-06
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 18 141 1.0E-06
sp|P47727|CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2 30 246 3.0E-06
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 17 141 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|041480
MGRRSFFGFLYDQLHRVPDVIQTDLKDKTAVVIGANTGIGFQAAQHFARMNTGRLILACRSEKRGQAAVDRLKVA
TGYSKAELWLVDLSAFSSVQAFADWTVKDLERLDILLLNAAVLHREDGSYTTTRDGWETTLHVNDLSFTLLSFLL
LPLMVDTAKKFNTHPRLVTVTSELHFMTSFEDKIFESPNAIEFMSDKDYCTPQIMKTRYPDTKLLNVFFTRALSN
RSKHQPVVFNCVNPGFCRSELLRDSKGMVIRLMSLLLAWSAEEGSRQLIWAAIGLPESGSLDEMRGAYINRASIE
EPSDFVLGEEGKKREDKLYADTISIIQKVDPRVKEIESQYLI*
Coding >Agabi119p4|041480
ATGGGCAGGAGAAGTTTCTTCGGCTTCCTCTATGATCAACTTCATCGAGTTCCCGATGTCATTCAGACAGATCTC
AAGGACAAGACGGCGGTCGTCATCGGCGCCAATACTGGTATTGGTTTTCAAGCTGCTCAACACTTCGCGAGAATG
AATACTGGAAGACTTATTCTTGCTTGTCGCAGCGAGAAGAGGGGCCAAGCAGCTGTGGATCGTTTGAAAGTAGCC
ACTGGCTATTCCAAGGCAGAATTGTGGTTGGTTGATCTTTCTGCATTCTCGTCCGTCCAAGCATTCGCCGATTGG
ACTGTGAAAGACCTAGAGAGGTTGGATATTCTATTGTTAAATGCTGCTGTTCTACATCGAGAAGATGGATCATAT
ACCACAACTAGAGATGGATGGGAGACAACACTCCACGTGAACGACCTTTCTTTCACATTGCTCTCTTTTTTGTTG
CTCCCTCTTATGGTTGACACCGCCAAGAAGTTTAACACACATCCAAGGCTCGTCACCGTCACAAGCGAGCTTCAC
TTCATGACAAGCTTCGAGGATAAAATATTTGAAAGTCCCAATGCAATCGAGTTCATGAGCGACAAAGATTACTGT
ACGCCCCAAATCATGAAAACTCGTTATCCTGATACGAAGCTTTTGAATGTATTTTTCACTCGCGCTCTCAGCAAC
CGATCGAAACACCAACCTGTTGTCTTCAATTGTGTTAACCCTGGCTTTTGTCGTTCCGAACTCCTCAGAGATTCG
AAGGGCATGGTTATCAGACTGATGTCATTGTTATTAGCCTGGAGTGCTGAAGAGGGTAGTCGCCAGCTAATCTGG
GCTGCTATCGGCCTTCCGGAGAGTGGGTCCTTGGATGAAATGAGAGGCGCATACATCAACAGAGCGAGCATAGAA
GAGCCTTCAGATTTTGTCCTTGGGGAAGAAGGTAAGAAAAGAGAAGATAAGTTATATGCCGACACGATTTCTATC
ATTCAAAAAGTGGATCCGCGCGTGAAAGAGATAGAGTCGCAGTATTTGATCTAA
Transcript >Agabi119p4|041480
ATGGGCAGGAGAAGTTTCTTCGGCTTCCTCTATGATCAACTTCATCGAGTTCCCGATGTCATTCAGACAGATCTC
AAGGACAAGACGGCGGTCGTCATCGGCGCCAATACTGGTATTGGTTTTCAAGCTGCTCAACACTTCGCGAGAATG
AATACTGGAAGACTTATTCTTGCTTGTCGCAGCGAGAAGAGGGGCCAAGCAGCTGTGGATCGTTTGAAAGTAGCC
ACTGGCTATTCCAAGGCAGAATTGTGGTTGGTTGATCTTTCTGCATTCTCGTCCGTCCAAGCATTCGCCGATTGG
ACTGTGAAAGACCTAGAGAGGTTGGATATTCTATTGTTAAATGCTGCTGTTCTACATCGAGAAGATGGATCATAT
ACCACAACTAGAGATGGATGGGAGACAACACTCCACGTGAACGACCTTTCTTTCACATTGCTCTCTTTTTTGTTG
CTCCCTCTTATGGTTGACACCGCCAAGAAGTTTAACACACATCCAAGGCTCGTCACCGTCACAAGCGAGCTTCAC
TTCATGACAAGCTTCGAGGATAAAATATTTGAAAGTCCCAATGCAATCGAGTTCATGAGCGACAAAGATTACTGT
ACGCCCCAAATCATGAAAACTCGTTATCCTGATACGAAGCTTTTGAATGTATTTTTCACTCGCGCTCTCAGCAAC
CGATCGAAACACCAACCTGTTGTCTTCAATTGTGTTAACCCTGGCTTTTGTCGTTCCGAACTCCTCAGAGATTCG
AAGGGCATGGTTATCAGACTGATGTCATTGTTATTAGCCTGGAGTGCTGAAGAGGGTAGTCGCCAGCTAATCTGG
GCTGCTATCGGCCTTCCGGAGAGTGGGTCCTTGGATGAAATGAGAGGCGCATACATCAACAGAGCGAGCATAGAA
GAGCCTTCAGATTTTGTCCTTGGGGAAGAAGGTAAGAAAAGAGAAGATAAGTTATATGCCGACACGATTTCTATC
ATTCAAAAAGTGGATCCGCGCGTGAAAGAGATAGAGTCGCAGTATTTGATCTAA
Gene >Agabi119p4|041480
ATGGGCAGGAGAAGTTTCTTCGGCTTCCTCTATGATCAACTTCATCGAGTTCCCGATGTCATTCAGACAGATCTC
AAGGACAAGACGGCGGTCGTCATCGGCGCCAATACTGGTATTGGTTTTCAAGCTGCTCAACACTTCGCGAGAATG
AATACTGGAAGACTTATTCTTGCTTGTCGCAGCGAGAAGAGGGGCCAAGCAGCTGTGGATCGTCAGTGCATTATG
TCTTGTTCTCGGTTTTTGACTAGTCGATTAATACGCATGATCCAGGTTTGAAAGTAGCCACTGGCTATTCCAAGG
CAGAATTGTGGTTGGTTGATCTTTCTGCATTCTCGTCCGTCCAAGCATTCGCCGATTGGACTGTGAAAGACCTAG
AGAGGTTGGATATTCTATTGTTAAATGCTGCTGTTCTACATCGAGAAGATGGATCATATACCACAACTAGAGATG
GATGGGAGACAACGTACGTGTTCATCTACCAAATCATGAAGGAACGTTAACGGTTGAATATGTCCAACTAGACTC
CACGTGAACGACCTTTCTTTCACATTGCTCTCTTTTTTGTTGCTCCCTCTTATGGTTGACACCGCCAAGAAGTTT
AACACACATCCAAGGCTCGTCACCGTCACAAGCGAGCTTCACTTCATGACAAGCTTCGAGGATAAAATATTTGAA
AGTCCCAATGCAATCGAGTTCATGAGCGACAAAGATTACTGTACGCCCCAGTGAGCTGGCATGTAAAACGTTGAC
TCGGCAAATAACTGATAACGAACAAGAATCATGAAAACTCGTTATCCTGATACGAAGCGTGAGTTGTTCCCTACA
TTCATTGGACCTTGCGTTGTTGATATTCTATTGCTAGTTTTGAATGTATTTTTCACTCGCGCTCTCAGCAACCGA
TCGAAACACCAACCTGTTGTCTTCAATTGTGTTAACCCTGGCTTTTGTCGTTCCGAACTCCTCAGAGATTCGAAG
GGCATGGTTATCAGACTGATGTCATTGTTATTAGCCTGGAGTGCTGAAGAGGGTAGTCGCCAGCTAATCTGGGCT
GCTATCGGCCTTCCGGAGAGTGGGTCCTTGGATGAAATGAGAGGCGCATACATCAACAGAGCGAGCATAGAAGAG
CCTTCAGATTTTGTCCTTGGGGAAGAAGGTAAGAAAAGAGAAGATAAGTTATATGTGAGTTCAAATCAAATGCTT
CGTATGTCAACATTATTGACAATACAATTTTCGGCAGGCCGACACGATTTCTATCATTCAAAAAGTGGATCCGCG
CGTGAAAGAGATAGAGTCGCAGTATTTGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail