Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|041050
Gene name
Locationscaffold_02:560066..563562
Strand-
Gene length (bp)3496
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01713 Smr Smr domain 1.7E-10 411 485

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 333 485 9.0E-15
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 339 501 2.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|041050
MLDIILCLVLVLWLVAEALSDKKPRSERSLLPQHHDGVRYTAPLHNGEQRSVSEHQRQSTPSSRALYVHQEQERI
SPPQHRDGVTNTVPQQRQSAPIARALYVHQEQERISPPQHRDGVTNTVPRQRQSAPPTRALHVHQEHERVSPPRH
RDGVTNAVPDQCRDIPPPRAQYVHQEQERIFLPNPLRAVQLGARGSSDECSGSEPPPLPQPRDNVRCTATLHDVE
QRSVSEHQLQSAPPPRAQNIQHERVSSPEPLQAVQLSTPAVPPGQDQTPLQTAPQHVNEPEQNSVLIPPATVSPS
EPKLEAAQTYQATEAALASDARGEVSHHPQDDTDEGSSDYVRLRERAKQERETVRKYREEKQQARASGQSTLFEE
LDEKIKYHSQRHQLLDERASRLIFEKNNKNRSPNQVDLHGLTAKEATTHAKRAIKEARERGVVQLRLIVGKGLHS
SGPPVLKPCMLKLMQELELPAEVLPSNEGVLVVQLVPTSTASPLATVHPSFLQPSLLNTSQPEPSPILVPHIDTS
PAEPFQWAHDVSLEPVWYGQESSQLFQNSAHHDAGYGIGDGFMLREYARQERQMKLNYRKEKKLAKTGGHLVLVR
ELAEKENEHRNRCDMFNAQASELIFAQNNKHGSLDWVVLHDLKAKEAKVHTKRVIEEARAKGIIKICLVVGEQSP
PGALKRAMLQFLRKKRELLVEVDPLYEGVLVVRLVSMSTESPPAVWDQTLLQPSLSQTSQPAPSPIVISHIDAPP
DRLTGDSIRGLAQNCEVTSTPLVPVGGEELSELPQNAAHRDAKDGNTDFMMLREYARQEKQKQLNCRMEKKRARA
GGQMALAMELAKQENEHQILRDLYDATASQLIFSKNNENGSLDRVVLQDLKAKEAKPHARRVIQEAREKGYTEIR
LVVGEQSASGALKPTMLNFLRKKCGLSVKVDAANEGILVVKLKP*
Coding >Agabi119p4|041050
ATGCTTGACATCATATTATGCTTAGTCCTAGTACTATGGCTGGTCGCTGAGGCTTTGAGTGATAAAAAGCCCAGA
TCCGAACGGTCACTTCTTCCTCAACATCACGATGGTGTTCGTTACACTGCACCGCTACATAATGGGGAACAGCGA
TCAGTGAGCGAACATCAACGCCAGAGCACTCCTTCCTCAAGGGCGCTATATGTGCATCAAGAGCAAGAACGAATC
TCTCCTCCTCAACATCGCGACGGTGTAACAAACACTGTCCCCCAACAACGCCAGAGCGCTCCTATCGCAAGGGCG
CTGTATGTACATCAAGAGCAAGAACGAATCTCTCCTCCTCAACATCGCGACGGTGTAACAAACACCGTCCCCCGA
CAACGCCAGAGTGCTCCTCCGACAAGGGCGCTACATGTACATCAAGAACACGAGCGAGTCTCTCCTCCTCGACAT
CGCGACGGTGTAACGAACGCTGTCCCAGATCAATGTCGGGATATTCCTCCTCCAAGGGCGCAATATGTACATCAG
GAGCAAGAGCGAATCTTTCTTCCCAATCCCCTTCGAGCTGTCCAACTGGGGGCTCGAGGCTCGAGCGACGAATGT
TCCGGTTCCGAACCGCCACCCCTTCCTCAACCTCGCGACAATGTCCGCTGCACTGCAACATTACATGATGTAGAG
CAGCGATCCGTAAGCGAACATCAATTGCAGAGCGCTCCTCCCCCAAGGGCGCAAAATATACAGCATGAACGAGTC
TCTTCTCCAGAACCTCTTCAAGCTGTCCAGCTCTCCACTCCTGCAGTTCCTCCGGGACAGGATCAGACGCCTCTC
CAAACTGCACCGCAGCATGTAAACGAACCGGAACAGAATTCTGTTCTTATTCCCCCGGCTACTGTGTCTCCCTCC
GAGCCCAAACTAGAGGCAGCTCAGACCTATCAAGCTACAGAGGCAGCTCTTGCATCCGATGCCAGGGGAGAAGTG
TCCCACCACCCCCAAGATGATACAGACGAAGGAAGCAGTGACTATGTCAGGCTCCGAGAACGTGCAAAGCAGGAG
AGAGAAACAGTACGGAAATATCGCGAGGAAAAGCAACAAGCTAGGGCCAGCGGTCAATCAACGCTCTTCGAAGAA
CTTGACGAAAAAATCAAGTATCATAGTCAACGCCATCAACTTCTCGATGAACGAGCCAGTCGTTTGATCTTTGAA
AAAAATAACAAGAATCGCTCACCGAACCAGGTCGACTTACACGGCCTTACGGCAAAGGAAGCAACCACCCACGCA
AAGCGTGCAATTAAGGAGGCCCGTGAAAGAGGCGTAGTCCAATTGCGCCTCATCGTTGGCAAGGGACTTCATTCA
TCAGGACCACCTGTACTCAAACCCTGCATGCTGAAGCTTATGCAAGAGCTTGAACTTCCTGCGGAAGTGCTTCCT
TCAAATGAAGGTGTACTAGTCGTTCAACTCGTTCCTACGAGCACTGCGTCTCCTCTGGCGACAGTTCATCCATCG
TTTTTGCAGCCCTCCTTGTTAAACACAAGCCAACCGGAACCAAGTCCTATTCTTGTTCCTCATATTGATACGTCC
CCCGCAGAACCCTTTCAATGGGCACATGATGTATCTCTAGAGCCTGTTTGGTATGGTCAAGAAAGTTCACAGCTC
TTCCAAAACTCAGCTCATCACGATGCGGGATATGGAATCGGTGATGGTTTCATGCTTCGGGAATATGCAAGGCAA
GAGAGACAAATGAAGTTGAATTACCGCAAGGAGAAAAAGCTAGCCAAAACCGGGGGTCACTTGGTGCTTGTCAGA
GAACTGGCTGAGAAAGAGAATGAACACAGAAATCGTTGTGATATGTTCAATGCGCAAGCGAGCGAGTTGATTTTT
GCCCAAAATAATAAGCATGGCTCATTGGACTGGGTCGTCTTGCACGACCTCAAGGCAAAGGAAGCGAAAGTCCAC
ACGAAGCGCGTTATCGAAGAGGCTCGTGCGAAAGGCATTATCAAAATATGCCTGGTTGTTGGTGAACAAAGTCCA
CCAGGTGCGCTCAAGCGCGCTATGCTTCAATTTTTGAGAAAAAAGCGTGAGCTCTTAGTGGAAGTTGATCCTTTA
TATGAAGGTGTACTGGTTGTTCGACTCGTTTCCATGAGTACTGAGTCTCCTCCTGCGGTTTGGGACCAAACGCTT
TTGCAGCCCTCCTTATCGCAGACAAGTCAACCGGCACCGAGTCCTATTGTTATTTCCCATATTGATGCGCCTCCT
GATCGACTGACCGGTGATTCAATCCGAGGCCTTGCACAGAACTGTGAGGTCACATCGACACCTCTTGTTCCTGTT
GGGGGTGAAGAGCTGTCAGAACTCCCCCAAAACGCAGCTCATCGTGATGCGAAAGATGGGAACACTGATTTTATG
ATGCTCCGGGAATATGCAAGGCAAGAGAAACAAAAGCAGTTGAATTGCCGTATGGAGAAGAAGCGAGCCCGAGCC
GGAGGCCAGATGGCGCTTGCCATGGAACTGGCTAAGCAAGAGAATGAACATCAAATTCTCCGTGACCTGTACGAC
GCAACAGCGAGCCAGCTAATTTTTTCCAAAAATAATGAGAACGGCTCGTTAGACAGGGTTGTCCTACAGGACCTC
AAAGCGAAGGAAGCGAAACCCCACGCAAGGCGTGTTATCCAAGAGGCTCGCGAGAAAGGCTATACCGAGATACGC
CTGGTTGTCGGTGAACAAAGTGCATCGGGTGCGCTCAAGCCCACTATGCTCAATTTTTTGAGAAAAAAGTGTGGA
CTCTCAGTGAAAGTCGATGCCGCAAATGAAGGAATACTGGTCGTCAAACTTAAACCCTGA
Transcript >Agabi119p4|041050
ATGCTTGACATCATATTATGCTTAGTCCTAGTACTATGGCTGGTCGCTGAGGCTTTGAGTGATAAAAAGCCCAGA
TCCGAACGGTCACTTCTTCCTCAACATCACGATGGTGTTCGTTACACTGCACCGCTACATAATGGGGAACAGCGA
TCAGTGAGCGAACATCAACGCCAGAGCACTCCTTCCTCAAGGGCGCTATATGTGCATCAAGAGCAAGAACGAATC
TCTCCTCCTCAACATCGCGACGGTGTAACAAACACTGTCCCCCAACAACGCCAGAGCGCTCCTATCGCAAGGGCG
CTGTATGTACATCAAGAGCAAGAACGAATCTCTCCTCCTCAACATCGCGACGGTGTAACAAACACCGTCCCCCGA
CAACGCCAGAGTGCTCCTCCGACAAGGGCGCTACATGTACATCAAGAACACGAGCGAGTCTCTCCTCCTCGACAT
CGCGACGGTGTAACGAACGCTGTCCCAGATCAATGTCGGGATATTCCTCCTCCAAGGGCGCAATATGTACATCAG
GAGCAAGAGCGAATCTTTCTTCCCAATCCCCTTCGAGCTGTCCAACTGGGGGCTCGAGGCTCGAGCGACGAATGT
TCCGGTTCCGAACCGCCACCCCTTCCTCAACCTCGCGACAATGTCCGCTGCACTGCAACATTACATGATGTAGAG
CAGCGATCCGTAAGCGAACATCAATTGCAGAGCGCTCCTCCCCCAAGGGCGCAAAATATACAGCATGAACGAGTC
TCTTCTCCAGAACCTCTTCAAGCTGTCCAGCTCTCCACTCCTGCAGTTCCTCCGGGACAGGATCAGACGCCTCTC
CAAACTGCACCGCAGCATGTAAACGAACCGGAACAGAATTCTGTTCTTATTCCCCCGGCTACTGTGTCTCCCTCC
GAGCCCAAACTAGAGGCAGCTCAGACCTATCAAGCTACAGAGGCAGCTCTTGCATCCGATGCCAGGGGAGAAGTG
TCCCACCACCCCCAAGATGATACAGACGAAGGAAGCAGTGACTATGTCAGGCTCCGAGAACGTGCAAAGCAGGAG
AGAGAAACAGTACGGAAATATCGCGAGGAAAAGCAACAAGCTAGGGCCAGCGGTCAATCAACGCTCTTCGAAGAA
CTTGACGAAAAAATCAAGTATCATAGTCAACGCCATCAACTTCTCGATGAACGAGCCAGTCGTTTGATCTTTGAA
AAAAATAACAAGAATCGCTCACCGAACCAGGTCGACTTACACGGCCTTACGGCAAAGGAAGCAACCACCCACGCA
AAGCGTGCAATTAAGGAGGCCCGTGAAAGAGGCGTAGTCCAATTGCGCCTCATCGTTGGCAAGGGACTTCATTCA
TCAGGACCACCTGTACTCAAACCCTGCATGCTGAAGCTTATGCAAGAGCTTGAACTTCCTGCGGAAGTGCTTCCT
TCAAATGAAGGTGTACTAGTCGTTCAACTCGTTCCTACGAGCACTGCGTCTCCTCTGGCGACAGTTCATCCATCG
TTTTTGCAGCCCTCCTTGTTAAACACAAGCCAACCGGAACCAAGTCCTATTCTTGTTCCTCATATTGATACGTCC
CCCGCAGAACCCTTTCAATGGGCACATGATGTATCTCTAGAGCCTGTTTGGTATGGTCAAGAAAGTTCACAGCTC
TTCCAAAACTCAGCTCATCACGATGCGGGATATGGAATCGGTGATGGTTTCATGCTTCGGGAATATGCAAGGCAA
GAGAGACAAATGAAGTTGAATTACCGCAAGGAGAAAAAGCTAGCCAAAACCGGGGGTCACTTGGTGCTTGTCAGA
GAACTGGCTGAGAAAGAGAATGAACACAGAAATCGTTGTGATATGTTCAATGCGCAAGCGAGCGAGTTGATTTTT
GCCCAAAATAATAAGCATGGCTCATTGGACTGGGTCGTCTTGCACGACCTCAAGGCAAAGGAAGCGAAAGTCCAC
ACGAAGCGCGTTATCGAAGAGGCTCGTGCGAAAGGCATTATCAAAATATGCCTGGTTGTTGGTGAACAAAGTCCA
CCAGGTGCGCTCAAGCGCGCTATGCTTCAATTTTTGAGAAAAAAGCGTGAGCTCTTAGTGGAAGTTGATCCTTTA
TATGAAGGTGTACTGGTTGTTCGACTCGTTTCCATGAGTACTGAGTCTCCTCCTGCGGTTTGGGACCAAACGCTT
TTGCAGCCCTCCTTATCGCAGACAAGTCAACCGGCACCGAGTCCTATTGTTATTTCCCATATTGATGCGCCTCCT
GATCGACTGACCGGTGATTCAATCCGAGGCCTTGCACAGAACTGTGAGGTCACATCGACACCTCTTGTTCCTGTT
GGGGGTGAAGAGCTGTCAGAACTCCCCCAAAACGCAGCTCATCGTGATGCGAAAGATGGGAACACTGATTTTATG
ATGCTCCGGGAATATGCAAGGCAAGAGAAACAAAAGCAGTTGAATTGCCGTATGGAGAAGAAGCGAGCCCGAGCC
GGAGGCCAGATGGCGCTTGCCATGGAACTGGCTAAGCAAGAGAATGAACATCAAATTCTCCGTGACCTGTACGAC
GCAACAGCGAGCCAGCTAATTTTTTCCAAAAATAATGAGAACGGCTCGTTAGACAGGGTTGTCCTACAGGACCTC
AAAGCGAAGGAAGCGAAACCCCACGCAAGGCGTGTTATCCAAGAGGCTCGCGAGAAAGGCTATACCGAGATACGC
CTGGTTGTCGGTGAACAAAGTGCATCGGGTGCGCTCAAGCCCACTATGCTCAATTTTTTGAGAAAAAAGTGTGGA
CTCTCAGTGAAAGTCGATGCCGCAAATGAAGGAATACTGGTCGTCAAACTTAAACCCTGA
Gene >Agabi119p4|041050
ATGCTTGACATCATATTATGCTTAGTCCTAGTACTATGGCTGGTCGCTGAGGCTTTGAGTGATAAAAAGCCCAGA
TCCGAACGGTCACTTCTTCCTCAACATCACGATGGTGTTCGTTACACTGCACCGCTACATAATGGGGAACAGCGA
TCAGTGAGCGAACATCAACGCCAGAGCACTCCTTCCTCAAGGGCGCTATATGTGCATCAAGAGCAAGAACGAATC
TCTCCTCCTCAACATCGCGACGGTGTAACAAACACTGTCCCCCAACAACGCCAGAGCGCTCCTATCGCAAGGGCG
CTGTATGTACATCAAGAGCAAGAACGAATCTCTCCTCCTCAACATCGCGACGGTGTAACAAACACCGTCCCCCGA
CAACGCCAGAGTGCTCCTCCGACAAGGGCGCTACATGTACATCAAGAACACGAGCGAGTCTCTCCTCCTCGACAT
CGCGACGGTGTAACGAACGCTGTCCCAGATCAATGTCGGGATATTCCTCCTCCAAGGGCGCAATATGTACATCAG
GAGCAAGAGCGAATCTTTCTTCCCAATCCCCTTCGAGCTGTCCAACTGGGGGCTCGAGGCTCGAGCGACGAATGT
TCCGGTTCCGAACCGCCACCCCTTCCTCAACCTCGCGACAATGTCCGCTGCACTGCAACATTACATGATGTAGAG
CAGCGATCCGTAAGCGAACATCAATTGCAGAGCGCTCCTCCCCCAAGGGCGCAAAATATACAGCATGAACGAGTC
TCTTCTCCAGAACCTCTTCAAGCTGTCCAGCTCTCCACTCCTGCAGTTCCTCCGGGACAGGATCAGACGCCTCTC
CAAACTGCACCGCAGCATGTAAACGAACCGGAACAGAATTCTGTTCTTATTCCCCCGGCTACTGTGTCTCCCTCC
GAGCCCAAACTAGAGGCAGCTCAGACCTATCAAGCTACAGAGGCAGCTCTTGCATCCGATGCCAGGGGAGAAGTG
TCCCACCACCCCCAAGTGAGCACACTCAGTCTCTTCCACAGAACAAACAATGATTGTTAATCTTCGTCCAGGATG
ATACAGACGAAGGAAGCAGTGACTATGTCAGGCTCCGAGAACGTGCAAAGCAGGAGAGAGAAACAGTACGGAAAT
ATCGCGAGGAAAAGCAACAAGCTAGGGCCAGCGGTCAATCAACGCTCTTCGAAGAACTTGACGAAAAAATCAAGT
ATCATAGTCAACGCCATCAACTTCTCGATGAACGAGCCAGTCGTTTGATCTTTGAAAGTAAGCGAACAATTTTCC
GTCAAAGATTAGAATACTGATACATGTCGTTCCAGAAAATAACAAGGTTCGTTACAAACTTGTATCATGACACTA
CGTGAATAACAAGTCTTTGTGGCAGAATCGCTCACCGAACCAGGTCGACTTACACGGCCTTACGGCAAAGGAAGC
AACCACCCACGCAAAGCGTGCAATTAAGGAGGCCCGTGAAAGAGGCGTAGTCCAATTGCGCCTCATCGTTGGCAA
GGGACTTCATTCATCAGGACCACCTGTACTCAAACCCTGCATGCTGAAGCTTATGCAAGAGTAAGCATCGTGATA
ATTACAAATCTAACCTTGTTAATTGTGGTGTAGGCTTGAACTTCCTGCGGAAGTGCTTCCTTCAAATGAAGGTGT
ACTAGTCGTTCAACTCGTTCCTACGAGCACTGCGTCTCCTCTGGCGACAGTTCATCCATCGTTTTTGCAGCCCTC
CTTGTTAAACACAAGCCAACCGGAACCAAGTCCTATTCTTGTTCCTCATATTGATACGTCCCCCGCAGAACCCTT
TCAATGGGCACATGATGTATCTCTAGAGCCTGTTTGGTATGGTCAAGAAAGTTCACAGCTCTTCCAAGTGAGCAC
CCTTTACCGTACAAGAGGCGGTTCTCGTTGACCAATTTTTCCCCCTAGAACTCAGCTCATCACGATGCGGGATAT
GGAATCGGTGATGGTTTCATGCTTCGGGAATATGCAAGGCAAGAGAGACAAATGAAGTTGAATTACCGCAAGGAG
AAAAAGCTAGCCAAAACCGGGGGTCACTTGGTGCTTGTCAGAGAACTGGCTGAGAAAGAGAATGAACACAGAAAT
CGTTGTGATATGTTCAATGCGCAAGCGAGCGAGTTGATTTTTGCCCGTATGTGCTTCTTTTTCCTTTTTTCTTGT
CGAACGGTTCAACACTGATAAAATTTTGCTTCCGTCAGAAAATAATAAGGTTCGTTGGTATTCAATATCTGATCA
TGACCCTGTGTAATCCCAAAATCTCCGTGTCATAGCATGGCTCATTGGACTGGGTCGTCTTGCACGACCTCAAGG
CAAAGGAAGCGAAAGTCCACACGAAGCGCGTTATCGAAGAGGCTCGTGCGAAAGGCATTATCAAAATATGCCTGG
TTGTTGGTGAACAAAGTCCACCAGGTGCGCTCAAGCGCGCTATGCTTCAATTTTTGAGAAAAAAGTAAGTGTTGT
GATGCTTACGACTGCAATTCTTCATAGATTCTTTTACAGGCGTGAGCTCTTAGTGGAAGTTGATCCTTTATATGA
AGGTGTACTGGTTGTTCGACTCGTTTCCATGAGTACTGAGTCTCCTCCTGCGGTTTGGGACCAAACGCTTTTGCA
GCCCTCCTTATCGCAGACAAGTCAACCGGCACCGAGTCCTATTGTTATTTCCCATATTGATGCGCCTCCTGATCG
ACTGACCGGTGATTCAATCCGAGGCCTTGCACAGAACTGTGAGGTCACATCGACACCTCTTGTTCCTGTTGGGGG
TGAAGAGCTGTCAGAACTCCCCCAAGTGAGCATCTGTTTCCGCTTAAGGGCTTGTTCTCGTTGACCCTCCCTTTA
GAACGCAGCTCATCGTGATGCGAAAGATGGGAACACTGATTTTATGATGCTCCGGGAATATGCAAGGCAAGAGAA
ACAAAAGCAGTTGAATTGCCGTATGGAGAAGAAGCGAGCCCGAGCCGGAGGCCAGATGGCGCTTGCCATGGAACT
GGCTAAGCAAGAGAATGAACATCAAATTCTCCGTGACCTGTACGACGCAACAGCGAGCCAGCTAATTTTTTCCAG
TACGTTCTTCTTTTTCTCATGGAATGGTTCAACACTGATAGGCTTTTGTTTCGTCAGAAAATAATGAGGTTCGTT
GGTATCCACGGTCTGGTTATGATCCTGCATAAATGCGAACCTCTGCCATAGAACGGCTCGTTAGACAGGGTTGTC
CTACAGGACCTCAAAGCGAAGGAAGCGAAACCCCACGCAAGGCGTGTTATCCAAGAGGCTCGCGAGAAAGGCTAT
ACCGAGATACGCCTGGTTGTCGGTGAACAAAGTGCATCGGGTGCGCTCAAGCCCACTATGCTCAATTTTTTGAGA
AAAAAGTACGTGTTGTGATACTTACAATTACAAAATTTTATCTAGCTTCTATAGGTGTGGACTCTCAGTGAAAGT
CGATGCCGCAAATGAAGGAATACTGGTCGTCAAACTTAAACCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail