Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040930
Gene name
Locationscaffold_02:534760..536617
Strand+
Gene length (bp)1857
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01170 UPF0020 Putative RNA methylase family UPF0020 5.2E-07 194 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12463|TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM11 PE=1 SV=1 4 455 6.0E-77
sp|O94636|TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm11 PE=3 SV=2 5 453 1.0E-76
sp|Q6NS23|TRM11_XENLA tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis GN=trmt11 PE=2 SV=1 4 456 6.0E-74
sp|Q5R962|TRM11_PONAB tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii GN=TRMT11 PE=2 SV=1 3 456 3.0E-70
sp|Q7Z4G4|TRM11_HUMAN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens GN=TRMT11 PE=1 SV=1 3 456 9.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12463|TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM11 PE=1 SV=1 4 455 6.0E-77
sp|O94636|TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm11 PE=3 SV=2 5 453 1.0E-76
sp|Q6NS23|TRM11_XENLA tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis GN=trmt11 PE=2 SV=1 4 456 6.0E-74
sp|Q5R962|TRM11_PONAB tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii GN=TRMT11 PE=2 SV=1 3 456 3.0E-70
sp|Q7Z4G4|TRM11_HUMAN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens GN=TRMT11 PE=1 SV=1 3 456 9.0E-70
sp|Q7TNK6|TRM11_RAT tRNA (guanine(10)-N2)-methyltransferase homolog OS=Rattus norvegicus GN=Trmt11 PE=2 SV=1 3 456 5.0E-68
sp|Q9CWH5|TRM11_MOUSE tRNA (guanine(10)-N2)-methyltransferase homolog OS=Mus musculus GN=Trmt11 PE=1 SV=1 3 456 1.0E-67
sp|Q05B63|TRM11_BOVIN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Bos taurus GN=TRMT11 PE=2 SV=1 3 456 6.0E-67
sp|Q6YJI5|TRM11_CHICK tRNA (guanine(10)-N2)-methyltransferase homolog OS=Gallus gallus GN=TRMT11 PE=2 SV=1 13 456 1.0E-64
sp|Q54QA6|TRM11_DICDI tRNA (guanine(10)-N2)-methyltransferase homolog OS=Dictyostelium discoideum GN=trmt11 PE=3 SV=1 4 451 7.0E-54
sp|Q58120|TMG10_METJA tRNA (guanine(10)-N2)-dimethyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trmG10 PE=3 SV=1 195 311 4.0E-09
sp|O26820|TMG10_METTH tRNA (guanine(10)-N2)-dimethyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trmG10 PE=3 SV=1 194 318 5.0E-09
sp|P05409|TMG10_METTL Probable tRNA (guanine(10)-N2)-dimethyltransferase (Fragment) OS=Methanothermococcus thermolithotrophicus GN=trmG10 PE=3 SV=1 206 311 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040930
MRTRYLVAFAQSHSDFRLPELQSISELHDFHIHLPDEPDTSRPFMVVELEDEKHAVILAKRCILIKSIYEFYAQG
ETYDEVHKMNRSHRHLWEKYIPNTSFKFNVTGFNHTIPQRRQRDVIENFAYMDFRGKIDMKNPEITMACFEEYEC
RQAPANGLPRKRCEDDGSFKEIFFGRLIVESTARQLVGVFDVKKRAYFGNTSMEAEISLLMANQTLASPGKLIYD
PFMGTGSMAYPIAYFGALVFGSDIDGRQMRGKGKPPGVIRAATQYGVASKIIDLCTFDVTHNPWRCGELFDAIIT
DPPYGVRAGAKRLGRKKELSEEKKALYFQHSQSPRPDDQPYIPPTKPYELSNLATDLVLLARYLLKPGGRLVFFL
PTVTDEYQEVDIHTMMCEGMEVIANSLQDFGSWGRRLITIRKTSNNKYLPPAYRPVAGEAENAHVPAHRDFREKY
FQGFNKDGDSLAA*
Coding >Agabi119p4|040930
ATGAGAACTCGTTATCTCGTCGCCTTTGCCCAATCTCATAGCGACTTCCGACTCCCAGAATTACAGTCGATCTCG
GAACTTCACGACTTTCACATCCATCTACCAGATGAGCCTGATACATCAAGGCCCTTCATGGTCGTGGAACTCGAG
GACGAGAAGCATGCGGTTATTTTGGCAAAACGATGCATCCTAATCAAGTCAATATACGAGTTTTATGCCCAGGGA
GAAACGTACGATGAAGTCCATAAAATGAACCGCTCCCATAGACACCTATGGGAGAAATACATCCCGAATACATCC
TTTAAATTCAACGTCACAGGATTCAATCATACAATACCTCAAAGAAGGCAGCGCGACGTTATTGAGAATTTCGCT
TACATGGACTTTCGGGGTAAAATTGACATGAAAAATCCCGAAATAACCATGGCATGCTTCGAAGAATACGAGTGC
CGTCAAGCGCCAGCGAATGGCCTCCCTCGCAAGCGGTGCGAAGATGACGGTAGTTTCAAAGAAATTTTCTTTGGG
AGGTTGATAGTAGAAAGTACTGCACGGCAACTGGTTGGCGTGTTTGACGTGAAGAAACGCGCCTACTTCGGGAAC
ACCAGCATGGAGGCCGAGATTTCTCTTCTTATGGCTAACCAAACTTTGGCCTCTCCAGGTAAATTGATATATGAC
CCCTTCATGGGAACTGGAAGCATGGCATATCCGATAGCATACTTTGGAGCTCTCGTATTCGGTTCAGATATTGAC
GGAAGGCAGATGAGGGGAAAAGGAAAGCCGCCAGGCGTCATACGGGCAGCAACTCAGTATGGCGTTGCCTCCAAG
ATCATCGACCTGTGCACATTCGACGTTACACATAATCCATGGAGATGTGGGGAATTATTTGACGCTATCATTACA
GACCCTCCTTATGGCGTTCGTGCAGGAGCGAAACGGCTCGGCCGCAAGAAAGAATTATCAGAGGAGAAGAAAGCG
CTTTATTTCCAGCACTCCCAGAGCCCAAGACCTGACGATCAGCCGTATATACCACCAACGAAACCTTATGAGCTA
TCCAATTTGGCAACGGATTTAGTTTTGCTCGCACGGTATCTACTTAAACCGGGGGGTCGATTAGTCTTTTTTCTC
CCTACTGTTACCGACGAATATCAAGAAGTCGACATCCATACTATGATGTGCGAAGGCATGGAAGTCATCGCAAAT
TCGCTACAAGATTTCGGTTCATGGGGCCGCCGCCTCATCACGATTCGAAAAACTTCAAATAATAAATACCTACCT
CCGGCGTATAGACCCGTCGCAGGCGAAGCTGAAAATGCACATGTCCCTGCACACCGAGATTTTAGGGAGAAGTAC
TTCCAGGGTTTCAACAAGGATGGTGATTCCTTAGCGGCATGA
Transcript >Agabi119p4|040930
ATGAGAACTCGTTATCTCGTCGCCTTTGCCCAATCTCATAGCGACTTCCGACTCCCAGAATTACAGTCGATCTCG
GAACTTCACGACTTTCACATCCATCTACCAGATGAGCCTGATACATCAAGGCCCTTCATGGTCGTGGAACTCGAG
GACGAGAAGCATGCGGTTATTTTGGCAAAACGATGCATCCTAATCAAGTCAATATACGAGTTTTATGCCCAGGGA
GAAACGTACGATGAAGTCCATAAAATGAACCGCTCCCATAGACACCTATGGGAGAAATACATCCCGAATACATCC
TTTAAATTCAACGTCACAGGATTCAATCATACAATACCTCAAAGAAGGCAGCGCGACGTTATTGAGAATTTCGCT
TACATGGACTTTCGGGGTAAAATTGACATGAAAAATCCCGAAATAACCATGGCATGCTTCGAAGAATACGAGTGC
CGTCAAGCGCCAGCGAATGGCCTCCCTCGCAAGCGGTGCGAAGATGACGGTAGTTTCAAAGAAATTTTCTTTGGG
AGGTTGATAGTAGAAAGTACTGCACGGCAACTGGTTGGCGTGTTTGACGTGAAGAAACGCGCCTACTTCGGGAAC
ACCAGCATGGAGGCCGAGATTTCTCTTCTTATGGCTAACCAAACTTTGGCCTCTCCAGGTAAATTGATATATGAC
CCCTTCATGGGAACTGGAAGCATGGCATATCCGATAGCATACTTTGGAGCTCTCGTATTCGGTTCAGATATTGAC
GGAAGGCAGATGAGGGGAAAAGGAAAGCCGCCAGGCGTCATACGGGCAGCAACTCAGTATGGCGTTGCCTCCAAG
ATCATCGACCTGTGCACATTCGACGTTACACATAATCCATGGAGATGTGGGGAATTATTTGACGCTATCATTACA
GACCCTCCTTATGGCGTTCGTGCAGGAGCGAAACGGCTCGGCCGCAAGAAAGAATTATCAGAGGAGAAGAAAGCG
CTTTATTTCCAGCACTCCCAGAGCCCAAGACCTGACGATCAGCCGTATATACCACCAACGAAACCTTATGAGCTA
TCCAATTTGGCAACGGATTTAGTTTTGCTCGCACGGTATCTACTTAAACCGGGGGGTCGATTAGTCTTTTTTCTC
CCTACTGTTACCGACGAATATCAAGAAGTCGACATCCATACTATGATGTGCGAAGGCATGGAAGTCATCGCAAAT
TCGCTACAAGATTTCGGTTCATGGGGCCGCCGCCTCATCACGATTCGAAAAACTTCAAATAATAAATACCTACCT
CCGGCGTATAGACCCGTCGCAGGCGAAGCTGAAAATGCACATGTCCCTGCACACCGAGATTTTAGGGAGAAGTAC
TTCCAGGGTTTCAACAAGGATGGTGATTCCTTAGCGGCATGA
Gene >Agabi119p4|040930
ATGAGAACTCGTTATCTCGTCGCCTTTGCCCAATCTCATAGCGACTTCCGACTCCCAGAATTACAGTCGATCTCG
GAACTTCACGACTTTCACATCCATCTACCAGATGAGCCTGATACATCAAGGCCCTTCATGGTCGTGGAACTCGAG
GACGAGAAGCATGCGGTTATTTTGGCAAAACGATGCATCCTAATCAAGTAATTCGATTCTTTATCCTTTCGATAA
ATATGTTTATTTTTTGGATCGTCCAAGGTCAATATACGAGTTTTATGCCCAGGGAGAAACGTACGATGAAGTCCA
TAAAATGAACCGCTCCCATAGACACCTATGGGAGAAATACATCCCGAATACATCCTTTAAATTCAACGTCACAGG
ATTCAATCATACAATACCTCAAAGAAGGCAGCGCGACGTTATTGAGAATTTCGCTTACATGGACTTTCGGGGTAA
AATTGACATGAAAAATCCCGAAATAACCATGGCATGCTTCGAAGAATGTGCGCTACTCTGTTGATGATGACTGTG
GTTAATCCTTGATTGTTTTTCTTTTACTTGTAGACGAGTGCCGTCAAGCGCCAGCGAATGGCCTCCCTCGCAAGC
GGTGCGAAGATGACGGTAGTTTCAAAGAAATTTTCTTTGGGAGGTTGGTGCGTCTGTCTCTGTATGCCAGGGATA
GCAACCCTAAATACACTTCAGATAGTAGAAAGTACTGCACGGCAACTGGTTGGCGTGTTTGACGTGAAGAAACGC
GCCTACTTCGGGAACACCAGCATGGAGGCCGAGATTTCTCTTCTTATGGCTAACCAAACTTTGGTCAGGCGGATC
ATCAGCCTATAATCAGCGAGAGACTCATACACGATAAAGGCCTCTCCAGGTAAATTGATATATGACCCCTTCATG
GGAACTGGAAGCATGGCATATGTAAGGTCAAATGTGTATGTGCCCTTTCTGCCTTAATTTTTTTAAATAGCCGAT
AGCATACTTTGGAGCTCTCGTATTCGGTTCAGATATTGACGGAAGGCAGATGAGGGGAAAAGGTAAGATATCTTA
CGTCCGAGAAATTATGATGAACTGCACAGCCCTCACAGGAAAGCCGCCAGGCGTCATACGGGCAGCAACTCAGTA
TGGCGTTGCCTCCAAGATCATCGACCTGTGCACATTCGACGTTACACATAATCCATGGAGATGTGGGGAATTATT
TGACGCTATCATTACAGACCCTCCTTGTGAGCTTTGCCACTGATCTGCTACCTGTGACTTCACGCATTATAGATG
GCGTTCGTGCAGGAGCGAAACGGCTCGGCCGCAAGAAAGAATTATCAGAGGAGAAGAAAGCGCTTTATTTCCAGC
ACTCCCAGAGCCCAAGACCGTATGTCACTATCAGTCATTTTGGTCTTCAGCATTATACTCTGCATCCAGTGACGA
TCAGCCGTATATACCACCAACGAAACCTTATGAGCTATCCAATTTGGCAACGGATTTAGTTTTGCTCGCACGGTA
TCTACTTAAACCGGGGGGTCGATTAGTCTTTTTTCTCCCTACTGTTACCGACGAATATCAAGAAGTCGACATCCA
TACTATGATGTGCGAAGGCATGGAAGTCATCGCAAATTCGCTACAAGATTTCGGTTCATGGGGCCGCCGCGTAAG
TCTTCGCTTGTAACTTCGATTCGCAGGAAAAATACAAGTTCCACACAGCTCATCACGATTCGAAAAACTTCAAAT
AATAAATACCTACCTCCGGCGTATAGACCCGTCGCAGGCGAAGCTGAAAATGCACATGTCCCTGCACACCGAGAT
TTTAGGGAGAAGTACTTCCAGGGTTTCAACAAGGATGGTGATTCCTTAGCGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail