Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040930
Gene name
Locationscaffold_02:534760..536617
Strand+
Gene length (bp)1857
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01170 UPF0020 Putative RNA methylase family UPF0020 5.2E-07 194 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12463|TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM11 PE=1 SV=1 4 455 6.0E-77
sp|O94636|TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm11 PE=3 SV=2 5 453 1.0E-76
sp|Q6NS23|TRM11_XENLA tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis GN=trmt11 PE=2 SV=1 4 456 6.0E-74
sp|Q5R962|TRM11_PONAB tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii GN=TRMT11 PE=2 SV=1 3 456 3.0E-70
sp|Q7Z4G4|TRM11_HUMAN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens GN=TRMT11 PE=1 SV=1 3 456 9.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12463|TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM11 PE=1 SV=1 4 455 6.0E-77
sp|O94636|TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm11 PE=3 SV=2 5 453 1.0E-76
sp|Q6NS23|TRM11_XENLA tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis GN=trmt11 PE=2 SV=1 4 456 6.0E-74
sp|Q5R962|TRM11_PONAB tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii GN=TRMT11 PE=2 SV=1 3 456 3.0E-70
sp|Q7Z4G4|TRM11_HUMAN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens GN=TRMT11 PE=1 SV=1 3 456 9.0E-70
sp|Q7TNK6|TRM11_RAT tRNA (guanine(10)-N2)-methyltransferase homolog OS=Rattus norvegicus GN=Trmt11 PE=2 SV=1 3 456 5.0E-68
sp|Q9CWH5|TRM11_MOUSE tRNA (guanine(10)-N2)-methyltransferase homolog OS=Mus musculus GN=Trmt11 PE=1 SV=1 3 456 1.0E-67
sp|Q05B63|TRM11_BOVIN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Bos taurus GN=TRMT11 PE=2 SV=1 3 456 6.0E-67
sp|Q6YJI5|TRM11_CHICK tRNA (guanine(10)-N2)-methyltransferase homolog OS=Gallus gallus GN=TRMT11 PE=2 SV=1 13 456 1.0E-64
sp|Q54QA6|TRM11_DICDI tRNA (guanine(10)-N2)-methyltransferase homolog OS=Dictyostelium discoideum GN=trmt11 PE=3 SV=1 4 451 7.0E-54
sp|Q58120|TMG10_METJA tRNA (guanine(10)-N2)-dimethyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trmG10 PE=3 SV=1 195 311 4.0E-09
sp|O26820|TMG10_METTH tRNA (guanine(10)-N2)-dimethyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trmG10 PE=3 SV=1 194 318 5.0E-09
sp|P05409|TMG10_METTL Probable tRNA (guanine(10)-N2)-dimethyltransferase (Fragment) OS=Methanothermococcus thermolithotrophicus GN=trmG10 PE=3 SV=1 206 311 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup3056
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|040930
Agaricus bisporus var bisporus H97 AgabiH97|040930
Agaricus bisporus var burnettii H119p4 Agabi119p4|040930 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040930
MRTRYLVAFAQSHSDFRLPELQSISELHDFHIHLPDEPDTSRPFMVVELEDEKHAVILAKRCILIKSIYEFYAQG
ETYDEVHKMNRSHRHLWEKYIPNTSFKFNVTGFNHTIPQRRQRDVIENFAYMDFRGKIDMKNPEITMACFEEYEC
RQAPANGLPRKRCEDDGSFKEIFFGRLIVESTARQLVGVFDVKKRAYFGNTSMEAEISLLMANQTLASPGKLIYD
PFMGTGSMAYPIAYFGALVFGSDIDGRQMRGKGKPPGVIRAATQYGVASKIIDLCTFDVTHNPWRCGELFDAIIT
DPPYGVRAGAKRLGRKKELSEEKKALYFQHSQSPRPDDQPYIPPTKPYELSNLATDLVLLARYLLKPGGRLVFFL
PTVTDEYQEVDIHTMMCEGMEVIANSLQDFGSWGRRLITIRKTSNNKYLPPAYRPVAGEAENAHVPAHRDFREKY
FQGFNKDGDSLAA*
Coding >Agabi119p4|040930
ATGAGAACTCGTTATCTCGTCGCCTTTGCCCAATCTCATAGCGACTTCCGACTCCCAGAATTACAGTCGATCTCG
GAACTTCACGACTTTCACATCCATCTACCAGATGAGCCTGATACATCAAGGCCCTTCATGGTCGTGGAACTCGAG
GACGAGAAGCATGCGGTTATTTTGGCAAAACGATGCATCCTAATCAAGTCAATATACGAGTTTTATGCCCAGGGA
GAAACGTACGATGAAGTCCATAAAATGAACCGCTCCCATAGACACCTATGGGAGAAATACATCCCGAATACATCC
TTTAAATTCAACGTCACAGGATTCAATCATACAATACCTCAAAGAAGGCAGCGCGACGTTATTGAGAATTTCGCT
TACATGGACTTTCGGGGTAAAATTGACATGAAAAATCCCGAAATAACCATGGCATGCTTCGAAGAATACGAGTGC
CGTCAAGCGCCAGCGAATGGCCTCCCTCGCAAGCGGTGCGAAGATGACGGTAGTTTCAAAGAAATTTTCTTTGGG
AGGTTGATAGTAGAAAGTACTGCACGGCAACTGGTTGGCGTGTTTGACGTGAAGAAACGCGCCTACTTCGGGAAC
ACCAGCATGGAGGCCGAGATTTCTCTTCTTATGGCTAACCAAACTTTGGCCTCTCCAGGTAAATTGATATATGAC
CCCTTCATGGGAACTGGAAGCATGGCATATCCGATAGCATACTTTGGAGCTCTCGTATTCGGTTCAGATATTGAC
GGAAGGCAGATGAGGGGAAAAGGAAAGCCGCCAGGCGTCATACGGGCAGCAACTCAGTATGGCGTTGCCTCCAAG
ATCATCGACCTGTGCACATTCGACGTTACACATAATCCATGGAGATGTGGGGAATTATTTGACGCTATCATTACA
GACCCTCCTTATGGCGTTCGTGCAGGAGCGAAACGGCTCGGCCGCAAGAAAGAATTATCAGAGGAGAAGAAAGCG
CTTTATTTCCAGCACTCCCAGAGCCCAAGACCTGACGATCAGCCGTATATACCACCAACGAAACCTTATGAGCTA
TCCAATTTGGCAACGGATTTAGTTTTGCTCGCACGGTATCTACTTAAACCGGGGGGTCGATTAGTCTTTTTTCTC
CCTACTGTTACCGACGAATATCAAGAAGTCGACATCCATACTATGATGTGCGAAGGCATGGAAGTCATCGCAAAT
TCGCTACAAGATTTCGGTTCATGGGGCCGCCGCCTCATCACGATTCGAAAAACTTCAAATAATAAATACCTACCT
CCGGCGTATAGACCCGTCGCAGGCGAAGCTGAAAATGCACATGTCCCTGCACACCGAGATTTTAGGGAGAAGTAC
TTCCAGGGTTTCAACAAGGATGGTGATTCCTTAGCGGCATGA
Transcript >Agabi119p4|040930
ATGAGAACTCGTTATCTCGTCGCCTTTGCCCAATCTCATAGCGACTTCCGACTCCCAGAATTACAGTCGATCTCG
GAACTTCACGACTTTCACATCCATCTACCAGATGAGCCTGATACATCAAGGCCCTTCATGGTCGTGGAACTCGAG
GACGAGAAGCATGCGGTTATTTTGGCAAAACGATGCATCCTAATCAAGTCAATATACGAGTTTTATGCCCAGGGA
GAAACGTACGATGAAGTCCATAAAATGAACCGCTCCCATAGACACCTATGGGAGAAATACATCCCGAATACATCC
TTTAAATTCAACGTCACAGGATTCAATCATACAATACCTCAAAGAAGGCAGCGCGACGTTATTGAGAATTTCGCT
TACATGGACTTTCGGGGTAAAATTGACATGAAAAATCCCGAAATAACCATGGCATGCTTCGAAGAATACGAGTGC
CGTCAAGCGCCAGCGAATGGCCTCCCTCGCAAGCGGTGCGAAGATGACGGTAGTTTCAAAGAAATTTTCTTTGGG
AGGTTGATAGTAGAAAGTACTGCACGGCAACTGGTTGGCGTGTTTGACGTGAAGAAACGCGCCTACTTCGGGAAC
ACCAGCATGGAGGCCGAGATTTCTCTTCTTATGGCTAACCAAACTTTGGCCTCTCCAGGTAAATTGATATATGAC
CCCTTCATGGGAACTGGAAGCATGGCATATCCGATAGCATACTTTGGAGCTCTCGTATTCGGTTCAGATATTGAC
GGAAGGCAGATGAGGGGAAAAGGAAAGCCGCCAGGCGTCATACGGGCAGCAACTCAGTATGGCGTTGCCTCCAAG
ATCATCGACCTGTGCACATTCGACGTTACACATAATCCATGGAGATGTGGGGAATTATTTGACGCTATCATTACA
GACCCTCCTTATGGCGTTCGTGCAGGAGCGAAACGGCTCGGCCGCAAGAAAGAATTATCAGAGGAGAAGAAAGCG
CTTTATTTCCAGCACTCCCAGAGCCCAAGACCTGACGATCAGCCGTATATACCACCAACGAAACCTTATGAGCTA
TCCAATTTGGCAACGGATTTAGTTTTGCTCGCACGGTATCTACTTAAACCGGGGGGTCGATTAGTCTTTTTTCTC
CCTACTGTTACCGACGAATATCAAGAAGTCGACATCCATACTATGATGTGCGAAGGCATGGAAGTCATCGCAAAT
TCGCTACAAGATTTCGGTTCATGGGGCCGCCGCCTCATCACGATTCGAAAAACTTCAAATAATAAATACCTACCT
CCGGCGTATAGACCCGTCGCAGGCGAAGCTGAAAATGCACATGTCCCTGCACACCGAGATTTTAGGGAGAAGTAC
TTCCAGGGTTTCAACAAGGATGGTGATTCCTTAGCGGCATGA
Gene >Agabi119p4|040930
ATGAGAACTCGTTATCTCGTCGCCTTTGCCCAATCTCATAGCGACTTCCGACTCCCAGAATTACAGTCGATCTCG
GAACTTCACGACTTTCACATCCATCTACCAGATGAGCCTGATACATCAAGGCCCTTCATGGTCGTGGAACTCGAG
GACGAGAAGCATGCGGTTATTTTGGCAAAACGATGCATCCTAATCAAGTAATTCGATTCTTTATCCTTTCGATAA
ATATGTTTATTTTTTGGATCGTCCAAGGTCAATATACGAGTTTTATGCCCAGGGAGAAACGTACGATGAAGTCCA
TAAAATGAACCGCTCCCATAGACACCTATGGGAGAAATACATCCCGAATACATCCTTTAAATTCAACGTCACAGG
ATTCAATCATACAATACCTCAAAGAAGGCAGCGCGACGTTATTGAGAATTTCGCTTACATGGACTTTCGGGGTAA
AATTGACATGAAAAATCCCGAAATAACCATGGCATGCTTCGAAGAATGTGCGCTACTCTGTTGATGATGACTGTG
GTTAATCCTTGATTGTTTTTCTTTTACTTGTAGACGAGTGCCGTCAAGCGCCAGCGAATGGCCTCCCTCGCAAGC
GGTGCGAAGATGACGGTAGTTTCAAAGAAATTTTCTTTGGGAGGTTGGTGCGTCTGTCTCTGTATGCCAGGGATA
GCAACCCTAAATACACTTCAGATAGTAGAAAGTACTGCACGGCAACTGGTTGGCGTGTTTGACGTGAAGAAACGC
GCCTACTTCGGGAACACCAGCATGGAGGCCGAGATTTCTCTTCTTATGGCTAACCAAACTTTGGTCAGGCGGATC
ATCAGCCTATAATCAGCGAGAGACTCATACACGATAAAGGCCTCTCCAGGTAAATTGATATATGACCCCTTCATG
GGAACTGGAAGCATGGCATATGTAAGGTCAAATGTGTATGTGCCCTTTCTGCCTTAATTTTTTTAAATAGCCGAT
AGCATACTTTGGAGCTCTCGTATTCGGTTCAGATATTGACGGAAGGCAGATGAGGGGAAAAGGTAAGATATCTTA
CGTCCGAGAAATTATGATGAACTGCACAGCCCTCACAGGAAAGCCGCCAGGCGTCATACGGGCAGCAACTCAGTA
TGGCGTTGCCTCCAAGATCATCGACCTGTGCACATTCGACGTTACACATAATCCATGGAGATGTGGGGAATTATT
TGACGCTATCATTACAGACCCTCCTTGTGAGCTTTGCCACTGATCTGCTACCTGTGACTTCACGCATTATAGATG
GCGTTCGTGCAGGAGCGAAACGGCTCGGCCGCAAGAAAGAATTATCAGAGGAGAAGAAAGCGCTTTATTTCCAGC
ACTCCCAGAGCCCAAGACCGTATGTCACTATCAGTCATTTTGGTCTTCAGCATTATACTCTGCATCCAGTGACGA
TCAGCCGTATATACCACCAACGAAACCTTATGAGCTATCCAATTTGGCAACGGATTTAGTTTTGCTCGCACGGTA
TCTACTTAAACCGGGGGGTCGATTAGTCTTTTTTCTCCCTACTGTTACCGACGAATATCAAGAAGTCGACATCCA
TACTATGATGTGCGAAGGCATGGAAGTCATCGCAAATTCGCTACAAGATTTCGGTTCATGGGGCCGCCGCGTAAG
TCTTCGCTTGTAACTTCGATTCGCAGGAAAAATACAAGTTCCACACAGCTCATCACGATTCGAAAAACTTCAAAT
AATAAATACCTACCTCCGGCGTATAGACCCGTCGCAGGCGAAGCTGAAAATGCACATGTCCCTGCACACCGAGAT
TTTAGGGAGAAGTACTTCCAGGGTTTCAACAAGGATGGTGATTCCTTAGCGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail