Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040870
Gene name
Locationscaffold_02:525429..526314
Strand-
Gene length (bp)885
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16242 Pyrid_ox_like Pyridoxamine 5'-phosphate oxidase like 6.7E-30 19 172
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 7.2E-13 23 106

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01358|BLI3_NEUCR Protein bli-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-3 PE=2 SV=1 3 189 3.0E-36

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040870
MLDPYTASASVITANTEQKIDGLKEIIESTQTAMLTTRSKEGHLHSRAMAPASSKEDKDLKFVFIANNASHKFEE
MRQDENVNVAFLNPSTTAWASIAGKAKVINNRDIVEKYWTKGTGAWFGDLKDGVHKGDASDPRVSLIEVIPEEIR
YWYPTEGKIMRAVEIGYDALTGGVATPGEIRNISPKEIRHHD*
Coding >Agabi119p4|040870
ATGCTTGACCCTTATACAGCTAGTGCTTCTGTGATCACAGCCAATACCGAGCAAAAGATCGATGGCTTGAAAGAG
ATCATAGAGTCTACTCAGACGGCGATGCTTACTACACGTTCTAAAGAAGGGCATCTTCATTCTCGTGCCATGGCA
CCCGCTTCTTCTAAAGAAGATAAAGACTTGAAATTTGTTTTTATCGCTAATAACGCTTCACATAAATTTGAAGAA
ATGCGTCAGGATGAGAATGTGAATGTAGCTTTTTTGAATCCTTCTACCACTGCTTGGGCTTCGATTGCGGGGAAA
GCTAAAGTCATAAACAACCGCGACATAGTCGAGAAATACTGGACCAAAGGAACAGGAGCATGGTTCGGTGACCTC
AAAGACGGAGTTCACAAAGGCGACGCCTCAGATCCTCGTGTATCTTTAATCGAAGTCATCCCAGAAGAAATTCGT
TATTGGTACCCTACTGAAGGTAAAATCATGCGAGCTGTGGAAATTGGTTATGATGCTCTTACGGGAGGTGTTGCT
ACTCCTGGTGAAATTAGGAATATCAGTCCTAAAGAGATACGCCACCATGATTAA
Transcript >Agabi119p4|040870
ATGCTTGACCCTTATACAGCTAGTGCTTCTGTGATCACAGCCAATACCGAGCAAAAGATCGATGGCTTGAAAGAG
ATCATAGAGTCTACTCAGACGGCGATGCTTACTACACGTTCTAAAGAAGGGCATCTTCATTCTCGTGCCATGGCA
CCCGCTTCTTCTAAAGAAGATAAAGACTTGAAATTTGTTTTTATCGCTAATAACGCTTCACATAAATTTGAAGAA
ATGCGTCAGGATGAGAATGTGAATGTAGCTTTTTTGAATCCTTCTACCACTGCTTGGGCTTCGATTGCGGGGAAA
GCTAAAGTCATAAACAACCGCGACATAGTCGAGAAATACTGGACCAAAGGAACAGGAGCATGGTTCGGTGACCTC
AAAGACGGAGTTCACAAAGGCGACGCCTCAGATCCTCGTGTATCTTTAATCGAAGTCATCCCAGAAGAAATTCGT
TATTGGTACCCTACTGAAGGTAAAATCATGCGAGCTGTGGAAATTGGTTATGATGCTCTTACGGGAGGTGTTGCT
ACTCCTGGTGAAATTAGGAATATCAGTCCTAAAGAGATACGCCACCATGATTAA
Gene >Agabi119p4|040870
ATGCTTGACCCTTATACAGCTAGTGCTTCTGTGATCACAGCCAATACCGAGCAAAAGATCGATGGTCGGTTGTGT
TCCTTTCTTCGAGGGTCTTGAAACTTAACATTATTATAGGCTTGAAAGAGATCATAGAGTCTACTCAGACGGCGA
TGCTTACTACACGTTCTAAAGAAGGGCATCTTCATTCTCGTGCCATGGCACCCGCTTCTTGTATGCAATCCTACC
CTCCCATTATCCACACAATACTCATAATATAATTTCGATTTTTAGCTAAAGAAGATAAAGACTTGAAATTTGTTT
TTATCGCTAATAACGCTTCACATAAATTTGAAGAAATGCGTCAGGATGAGAATGTGAATGTAGCTTTTTTGAATC
CTTCTACCACTGCTTGGGCTTCGTATGTGTTTTCTCTCTCTCTCTCTCTCAAACCATTTAAAATAACTTTGTTTT
TGCGTTTTTATTTAGGATTGCGGGGAAAGCTAAAGTCATAAACAACCGCGACATAGTCGAGAAATACTGGACCAA
AGGGTAAATGAACCAAACCCTCTCCTCCTCCATATTCAAACGACTGATGTTCATAATTCAGAACAGGAGCATGGT
TCGGTGACCTCAAAGACGGAGTTCACAAAGGCGACGCCTCAGATCCTCGTGTATCTTTAATCGAAGTCATCCCAG
AAGAAATTCGTTATTGGTACCCTACTGAAGGTAAAATCATGCGAGCTGTGGAAATTGGTTATGATGCTCTTACGG
GAGGTGTTGCTACTCCTGGTGAAATTAGGAATATCAGTCCTAAAGAGGTTCGTTCGTCTTTTGTCGAGATAAGAT
GGTTCGTTTCATGATTGATTTGACGCTTTTTTTTTTTTATAGATACGCCACCATGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail