Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040790
Gene name
Locationscaffold_02:514755..517306
Strand-
Gene length (bp)2551
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 2.5E-28 81 298
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 2.2E-22 464 572

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 90 578 9.0E-39
sp|P0CS93|GAOA_GIBZA Galactose oxidase OS=Gibberella zeae GN=GAOA PE=1 SV=1 343 572 1.0E-06
sp|I1S2N3|GAOA_GIBZE Galactose oxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GAOA PE=3 SV=1 343 572 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040790
MWALLHPLATLAISASVAGSAGAQLTIPAPGQPSRKGTIGAFEIIGDSLVSAQQLFVGTPETVYFVDKAENNPAQ
IAGHPAWASEWSLASNNQRPMDVVTNSFCAGGNVLGNGTWMNVGGNQAVTYGGVAASQDGNNAFGDADGRQSIRL
LDPCDDGTCDWNLSPHQVGQRWYPTLETLEDGTMIILGGCQFGGYVNAEFQDNPTYEFFPPRGEPIRSRILATTL
PANLFPLTWLLPSGLLLVQSNWATVLLNYTSHKEIPLDNIPDAVRVYPASAGTTMLPLTPANNYTATILFCGGSN
IQPERWTSSSFIIPTYAASASCVTLTPDVSGSYTSDDPLPEGRSMLNFILLPDGKVFGVNGAKMGTAGYGNDSWA
IGQSYADGPVLLPIMYDPNAPSGQKFSRDGMEASTVPRMYHSSATLLPDGSVMISGSNPNADYIVGPDVTYPTEY
RTELFYPSYYNERRPEPEGLIPQLSYGGPTFDIQLDSDDLFGDINNVKEARVVILRTGFSTHAMNMGQRYLQLES
SYNGYSNNTATLHVRQMPPNPRLFAPGPAFVFVVVNGVPSIGQPVMIGSGQLGPQEPQPQGDLPSSLIQQPPSDN
SDSRDNGGLPGASSLSLSKMTLCAFATALGGLITGW*
Coding >Agabi119p4|040790
ATGTGGGCCCTCCTGCATCCTCTAGCGACTCTTGCCATCTCCGCTAGTGTTGCTGGCTCCGCAGGCGCCCAGCTC
ACTATTCCCGCCCCAGGCCAACCGTCCCGGAAAGGAACCATCGGTGCCTTTGAGATCATAGGTGACAGTCTGGTC
AGCGCCCAACAGCTTTTTGTTGGTACTCCCGAGACAGTTTACTTCGTTGATAAAGCAGAGAACAACCCGGCTCAA
ATCGCGGGTCATCCTGCCTGGGCTTCCGAATGGAGTTTGGCTTCAAACAATCAACGGCCGATGGATGTGGTGACG
AATTCGTTCTGTGCTGGTGGAAATGTTCTTGGCAATGGAACATGGATGAATGTTGGGGGGAACCAGGCAGTCACT
TATGGTGGGGTTGCTGCCTCGCAAGATGGAAACAATGCGTTTGGTGACGCGGATGGGCGACAATCAATTCGGTTG
CTGGACCCTTGCGATGACGGAACGTGTGATTGGAATCTTTCTCCACATCAAGTAGGACAGAGGTGGTACCCCACG
CTTGAAACCCTAGAAGATGGCACAATGATCATTCTTGGCGGGTGTCAATTTGGTGGTTATGTAAATGCCGAATTC
CAAGATAACCCTACATATGAATTCTTTCCTCCACGAGGAGAGCCTATAAGGTCACGCATTCTGGCGACGACCCTT
CCGGCCAACCTCTTTCCGCTGACCTGGTTGCTTCCATCGGGGCTTTTGCTTGTGCAGTCAAATTGGGCGACAGTC
CTTTTAAATTACACAAGTCACAAGGAGATACCATTGGATAATATTCCTGATGCTGTCCGAGTATACCCCGCTAGT
GCTGGTACTACTATGCTTCCCCTTACACCTGCTAATAACTACACCGCTACTATTCTATTTTGTGGAGGTTCGAAC
ATCCAGCCAGAAAGGTGGACATCGTCTAGCTTTATAATACCCACATATGCCGCATCGGCCTCGTGTGTTACTTTA
ACTCCCGACGTCTCGGGTTCATATACTTCCGATGACCCACTTCCCGAAGGGAGATCGATGCTCAACTTCATCTTA
CTTCCAGATGGCAAAGTCTTCGGTGTCAATGGAGCCAAAATGGGAACGGCGGGATACGGTAATGATTCTTGGGCC
ATTGGACAATCGTATGCAGATGGTCCAGTGTTGTTGCCTATCATGTATGACCCCAATGCACCGTCTGGTCAGAAA
TTTTCTCGAGATGGCATGGAGGCTAGCACTGTTCCGCGCATGTACCACTCTTCAGCTACTCTTCTACCTGATGGT
TCTGTGATGATTTCGGGATCTAACCCTAACGCGGATTATATCGTTGGTCCGGATGTCACGTACCCTACGGAATAT
CGGACAGAACTGTTCTACCCTTCATATTACAACGAGAGAAGACCTGAACCCGAGGGCCTTATTCCCCAACTTTCC
TATGGTGGACCTACCTTTGATATTCAACTGGACTCGGATGATCTCTTTGGTGACATCAACAATGTCAAGGAAGCT
CGTGTAGTCATCCTCCGTACAGGGTTTTCAACTCACGCTATGAATATGGGCCAACGTTACTTGCAGCTTGAAAGC
TCGTACAATGGGTACAGCAATAACACTGCTACACTCCACGTCCGCCAGATGCCGCCTAACCCCCGTCTCTTCGCC
CCTGGACCCGCGTTTGTCTTCGTCGTTGTGAACGGTGTTCCATCTATCGGCCAACCAGTGATGATCGGTTCTGGT
CAACTGGGGCCACAGGAACCTCAACCTCAGGGTGATTTGCCTTCATCGTTAATTCAACAACCTCCGAGTGACAAT
TCGGACTCGCGTGATAATGGTGGCCTACCAGGTGCCAGCTCTTTGTCGCTCTCAAAAATGACATTGTGTGCTTTT
GCAACCGCCCTAGGTGGCCTGATTACCGGCTGGTAA
Transcript >Agabi119p4|040790
ATGTGGGCCCTCCTGCATCCTCTAGCGACTCTTGCCATCTCCGCTAGTGTTGCTGGCTCCGCAGGCGCCCAGCTC
ACTATTCCCGCCCCAGGCCAACCGTCCCGGAAAGGAACCATCGGTGCCTTTGAGATCATAGGTGACAGTCTGGTC
AGCGCCCAACAGCTTTTTGTTGGTACTCCCGAGACAGTTTACTTCGTTGATAAAGCAGAGAACAACCCGGCTCAA
ATCGCGGGTCATCCTGCCTGGGCTTCCGAATGGAGTTTGGCTTCAAACAATCAACGGCCGATGGATGTGGTGACG
AATTCGTTCTGTGCTGGTGGAAATGTTCTTGGCAATGGAACATGGATGAATGTTGGGGGGAACCAGGCAGTCACT
TATGGTGGGGTTGCTGCCTCGCAAGATGGAAACAATGCGTTTGGTGACGCGGATGGGCGACAATCAATTCGGTTG
CTGGACCCTTGCGATGACGGAACGTGTGATTGGAATCTTTCTCCACATCAAGTAGGACAGAGGTGGTACCCCACG
CTTGAAACCCTAGAAGATGGCACAATGATCATTCTTGGCGGGTGTCAATTTGGTGGTTATGTAAATGCCGAATTC
CAAGATAACCCTACATATGAATTCTTTCCTCCACGAGGAGAGCCTATAAGGTCACGCATTCTGGCGACGACCCTT
CCGGCCAACCTCTTTCCGCTGACCTGGTTGCTTCCATCGGGGCTTTTGCTTGTGCAGTCAAATTGGGCGACAGTC
CTTTTAAATTACACAAGTCACAAGGAGATACCATTGGATAATATTCCTGATGCTGTCCGAGTATACCCCGCTAGT
GCTGGTACTACTATGCTTCCCCTTACACCTGCTAATAACTACACCGCTACTATTCTATTTTGTGGAGGTTCGAAC
ATCCAGCCAGAAAGGTGGACATCGTCTAGCTTTATAATACCCACATATGCCGCATCGGCCTCGTGTGTTACTTTA
ACTCCCGACGTCTCGGGTTCATATACTTCCGATGACCCACTTCCCGAAGGGAGATCGATGCTCAACTTCATCTTA
CTTCCAGATGGCAAAGTCTTCGGTGTCAATGGAGCCAAAATGGGAACGGCGGGATACGGTAATGATTCTTGGGCC
ATTGGACAATCGTATGCAGATGGTCCAGTGTTGTTGCCTATCATGTATGACCCCAATGCACCGTCTGGTCAGAAA
TTTTCTCGAGATGGCATGGAGGCTAGCACTGTTCCGCGCATGTACCACTCTTCAGCTACTCTTCTACCTGATGGT
TCTGTGATGATTTCGGGATCTAACCCTAACGCGGATTATATCGTTGGTCCGGATGTCACGTACCCTACGGAATAT
CGGACAGAACTGTTCTACCCTTCATATTACAACGAGAGAAGACCTGAACCCGAGGGCCTTATTCCCCAACTTTCC
TATGGTGGACCTACCTTTGATATTCAACTGGACTCGGATGATCTCTTTGGTGACATCAACAATGTCAAGGAAGCT
CGTGTAGTCATCCTCCGTACAGGGTTTTCAACTCACGCTATGAATATGGGCCAACGTTACTTGCAGCTTGAAAGC
TCGTACAATGGGTACAGCAATAACACTGCTACACTCCACGTCCGCCAGATGCCGCCTAACCCCCGTCTCTTCGCC
CCTGGACCCGCGTTTGTCTTCGTCGTTGTGAACGGTGTTCCATCTATCGGCCAACCAGTGATGATCGGTTCTGGT
CAACTGGGGCCACAGGAACCTCAACCTCAGGGTGATTTGCCTTCATCGTTAATTCAACAACCTCCGAGTGACAAT
TCGGACTCGCGTGATAATGGTGGCCTACCAGGTGCCAGCTCTTTGTCGCTCTCAAAAATGACATTGTGTGCTTTT
GCAACCGCCCTAGGTGGCCTGATTACCGGCTGGTAA
Gene >Agabi119p4|040790
ATGTGGGCCCTCCTGCATCCTCTAGCGACTCTTGCCATCTCCGCTAGTGTTGCTGGCTCCGCAGGCGCCCAGCTC
ACTATTCCCGCCCCAGGCCAACCGTCCCGGAAAGGAACCATCGGTGCCTTTGAGATCATAGGTGACAGTCTGGTC
AGCGCCCAACAGGTATGTTTAACTTAAACGATTGCCATGGTATCCTTCGCCTACTCATCGCCATCCATCTAGCTT
TTTGTTGGTACTCCCGAGACAGTTTACTTCGTTGATAAAGCAGAGAACAACCCGGCTCAAATCGCGGGTCATCCT
GCCTGGGCTTCCGGTGTGTATCCTTTCATTTTCGTTCAGCGACCCAGCCAACATATCCTTTCCATATGACAGAAT
GGAGTTTGGCTTCAAACAATCAACGGCCGATGGATGTGGTGACGAATTCGTTCTGTGCTGTAAGTTTCGCGCGGT
ATTTATAGACTTATGCCTCATCGTGTTCGAATTTAGGGTGGAAATGTTCTTGGCAATGGAACATGGATGAATGTT
GGGGGGAACCAGGCAGTCACTTATGGTGGGGTTGCTGCCTCGCAAGATGGAAACAATGCGTTTGGTGACGCGGAT
GGGCGACAATCGTGAGTTGACTGTTTTACGGGTCATTGGTGTATGTACTGATAATTGCGTTAACAGAATTCGGTA
TGTTACTGTTATTGTTTAAAGCGTGCTGAAGGCGCGCCGCGGTCCAAGGATCAATTTCTGACATCTGATGCTGCA
GGTTGCTGGACCCTTGCGATGACGGAACGTGTGATTGGAATCTTTCTCCACATCAAGTAGGACAGAGGTGGTACC
CCACGCTGTAAGCCCCTTCTGGAAAGCAATCTACGCGATCTGATCGTTCGTTCCTTGACAGTGAAACCCTAGAAG
ATGGCACAATGATCATTGTCAGTCAAGTGCCCTTCCAAAGTGTTTTGACGCTCAGAATTGATTTTGCAGCTTGGC
GGGTGTCAATTTGGTGGTTATGTAAATGCCGAATTCCAAGATAACCCTACATATGAATTCTTTCCTCCACGAGGA
GAGCCTATAAGGTCACGCATTCTGGCGACGACCCTTCCGGCCAACCTCTTTCCGCTGACCTGGTTGCTTCCATCG
GGGCTTTTGCTTGTGCAGTCAAATTGGGCGACAGTCCTTTTAAATTACACAAGTCACAAGGAGATACCATTGGAT
AATATTCCTGATGCTGTCCGAGTATACCCCGCTAGTGCTGGTACTACTATGCTTCCCCTTACACCTGCTAATAAC
TACACCGCTACTATTCTATTTTGTGGAGGTTCGAACATCCAGCCAGAAAGGTGGGTTGATTACGCTTGTATGGAT
GGGTGTCTTCTAACCCACTGTCCTATAATTTGCAGGTGGACATCGTCTAGCTTTATAATACCCACATATGCCGCA
TCGGCCTCGTGTGTTACTTTAACTCCCGACGTCTCGGGTTCATATACTTCCGATGACCCACTTCCCGAAGGGAGA
TCGATGCTCAACTTCATCTTACTTCCAGATGGCAAAGTCTTCGGTGTCAATGGAGCCAAAATGGGTATGTACCGG
TGTTCCTTCCTTTTTCAGATACATCAATGGTCGACCTCCTCTTTCTAGGAACGGCGGGATACGGTAATGATTCTT
GGGCCATTGGACAATCGTATGCAGATGGTCCAGTGTTGTTGCCTATCATGTATGACCCCAATGCACCGTCTGGTC
AGAAATTTTCTCGAGATGGCATGGAGGCTAGCACTGTTCCGCGCATGTACCACTCTTCAGCTACTCTTCTACCTG
ATGGTATGTTGGCTATTGATTCTGAACATGTCGATTTGTGCTCACTGCGTTTCCCTTAGGTTCTGTGATGATTTC
GGGATCTAACCCTAACGCGGATTATATCGTTGGTCCGGATGTCACGTACCCTACGGAATATCGGACAGAACTGTT
CTACCCTTCATATTACAACGAGAGAAGACCTGAACCCGAGGGCCTTATTCCCCAACTTTCCTATGGTGGACCTAC
CTTTGATATTCAACTGGACTCGGATGATCTCTTTGGTGACATCAACAATGTCAAGGAAGCTCGTGTAGTCATCCT
CCGTACAGGGTTTTCAACTCACGCTATGGTTCGTCTGCATCTTCAGCATGAGCTTTGTGGCTTACTGATGTATTG
CCACCAGAATATGGGCCAACGTTACTTGCAGCTTGAAAGCTCGTACAATGGGTACAGCAATAACACTGCTACACT
CCACGTCCGCCAGATGCCGCCTAACCCCCGTCTCTTCGCCCCTGGACCCGCGTTTGTCTTCGTCGTTGTGAACGG
TGTTCCATCTATCGGCCAACCAGTGATGATCGGTTCTGGTCAACTGGGGCCACAGGAACCTCAACCTCAGGGTGA
TTTGCCTTCATCGTTAATTCAACAACCTCCGAGTGACAATTCGGACTCGCGTGATAATGGTGGCCTACCAGGTGC
CAGCTCTTTGTCGCTCTCAAAAATGACATTGTGTGCTTTTGCAACCGCCCTAGGTGGCCTGATTACCGGCTGGTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail