Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040680
Gene name
Locationscaffold_02:493029..494422
Strand+
Gene length (bp)1393
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 3.6E-18 100 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 99 252 2.0E-13
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 99 252 1.0E-12
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 67 252 3.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 99 253 2.0E-06
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 106 253 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 99 252 2.0E-13
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 99 252 1.0E-12
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 67 252 3.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 99 253 2.0E-06
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 106 253 2.0E-06
sp|P04957|GUB_BACSU Beta-glucanase OS=Bacillus subtilis (strain 168) GN=bglS PE=1 SV=2 95 253 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040680
MEAPFRFGLMRFYFHMAAYKTTRAHLASFITLLLVQVSVQAACDTYTVSGIPGGFTRRLFADFSNVSPGGDAASL
LSSFGIGISSDTVRSTPIPRTSVPSNIALGNGALNLKVSRYSGSGAVQSAEMVTRDTFKFASVRTSMKSSKTPGV
VEGNFFYLNDNQEIDWETLTSTISTSSQCVPAGIWATNQRAFAGAPATDATIPFTFDPTADFHEYRIDWSSDATA
FYIDGQRKARFTQNVPTQAGHWIWNVWSSGDPCWSNGPPTADSITQIRSIEMFTGWTSTVSGNVCSA*
Coding >Agabi119p4|040680
ATGGAAGCCCCTTTCCGCTTTGGTCTCATGAGATTCTACTTTCACATGGCGGCGTATAAAACTACTAGAGCTCAC
CTGGCATCTTTCATCACTCTGCTGCTAGTCCAAGTGTCAGTGCAGGCAGCTTGCGATACCTACACCGTCAGCGGA
ATTCCTGGTGGCTTCACCCGGCGATTGTTTGCAGATTTTTCTAATGTATCCCCCGGCGGTGATGCTGCGTCTCTT
CTCAGCTCTTTTGGGATAGGCATCAGCTCTGACACTGTTCGTTCTACGCCCATTCCTCGGACTTCTGTTCCGTCA
AACATAGCTCTGGGAAATGGAGCTTTGAATCTTAAGGTCTCCCGGTATTCCGGCAGCGGAGCAGTCCAAAGCGCG
GAGATGGTCACGCGCGACACTTTCAAATTTGCTTCAGTTCGTACTTCCATGAAATCAAGCAAAACTCCGGGTGTT
GTCGAGGGCAACTTTTTTTATCTGAATGACAATCAAGAAATTGATTGGGAAACTTTGACGAGTACCATATCCACT
TCTAGTCAATGTGTTCCCGCCGGAATTTGGGCGACAAACCAGCGCGCGTTCGCAGGTGCGCCTGCGACCGATGCA
ACAATTCCATTCACTTTTGATCCCACCGCGGATTTCCATGAGTATCGTATTGATTGGTCGTCTGACGCCACAGCA
TTCTATATCGATGGACAACGGAAGGCTCGCTTCACGCAGAATGTTCCGACGCAAGCGGGTCATTGGATTTGGAAT
GTATGGAGCAGTGGAGATCCTTGCTGGTCGAACGGTCCTCCGACGGCGGACTCTATAACTCAAATTCGGTCAATT
GAAATGTTCACAGGATGGACTTCAACGGTCTCCGGGAATGTGTGCAGCGCATAA
Transcript >Agabi119p4|040680
ATGGAAGCCCCTTTCCGCTTTGGTCTCATGAGATTCTACTTTCACATGGCGGCGTATAAAACTACTAGAGCTCAC
CTGGCATCTTTCATCACTCTGCTGCTAGTCCAAGTGTCAGTGCAGGCAGCTTGCGATACCTACACCGTCAGCGGA
ATTCCTGGTGGCTTCACCCGGCGATTGTTTGCAGATTTTTCTAATGTATCCCCCGGCGGTGATGCTGCGTCTCTT
CTCAGCTCTTTTGGGATAGGCATCAGCTCTGACACTGTTCGTTCTACGCCCATTCCTCGGACTTCTGTTCCGTCA
AACATAGCTCTGGGAAATGGAGCTTTGAATCTTAAGGTCTCCCGGTATTCCGGCAGCGGAGCAGTCCAAAGCGCG
GAGATGGTCACGCGCGACACTTTCAAATTTGCTTCAGTTCGTACTTCCATGAAATCAAGCAAAACTCCGGGTGTT
GTCGAGGGCAACTTTTTTTATCTGAATGACAATCAAGAAATTGATTGGGAAACTTTGACGAGTACCATATCCACT
TCTAGTCAATGTGTTCCCGCCGGAATTTGGGCGACAAACCAGCGCGCGTTCGCAGGTGCGCCTGCGACCGATGCA
ACAATTCCATTCACTTTTGATCCCACCGCGGATTTCCATGAGTATCGTATTGATTGGTCGTCTGACGCCACAGCA
TTCTATATCGATGGACAACGGAAGGCTCGCTTCACGCAGAATGTTCCGACGCAAGCGGGTCATTGGATTTGGAAT
GTATGGAGCAGTGGAGATCCTTGCTGGTCGAACGGTCCTCCGACGGCGGACTCTATAACTCAAATTCGGTCAATT
GAAATGTTCACAGGATGGACTTCAACGGTCTCCGGGAATGTGTGCAGCGCATAA
Gene >Agabi119p4|040680
ATGGGTCAGAGCTTTATCAGCTTCTCAGTGATGCGGACGACATCTAATTGTCATCTCCACATGTAAAGAAGCCCC
TTTCCGCGTGAGTCGAGACCAGGTCGAAACCAAAATCTCTGGACCAAGTGTGCACTTGACCAAGAGAGTTTGGTC
TCATGAGATTCTACTTTCACATGGCGGCGTATAAAACTACTAGGTGAGCTCTGCACTAGAATACAACAAACAAGT
GATGACACCTCACTTCAGAGCTCACCTGGCATCTTTCATCACTCTGCTGCTAGTCCAAGTGTCAGTGCAGGCAGC
TTGCGATACCTACACCGTCAGCGGAATTCCTGGTGGCTTCACCCGGCGATTGTTTGCAGATTTTTCTAATGTATC
CCCCGGCGGTGATGCTGCGTCTCTTCTCAGGTAATTATATTATGGAACTTCTGAAAATGGTCCATGATATCGACC
GCAAACTAGCTCTTTTGGGATAGGCATCAGCTCTGACACTGTTCGTTCTACGCCCATTCCTCGGACTTCTGTTCC
GTCAAACATAGCTCTGGGAAATGGAGCTTTGAATCTTAAGGTCTCCCGGTATTCCGGCAGCGGAGCAGTCCAAAG
CGCGGAGATGGTCACGCGCGACACTTTCAAATTTGCTTCAGTTCGTACTTCCATGAAATCAAGCAAAACTCCGGG
TGTTGTCGAGGGCAACTTTTTTTATCGTAAGTATGTGAAACTTTTCACCTTTTGGAGTCTTGATGAAAGTACTCT
TTTTAAGTGAATGACAATCAAGAAATTGATTGGGAAACTTTGACGAGTACCATATCCACTTCTAGTCAATGTGTT
CCCGCCGGAATTTGGGCGACAAACCAGGTGAGAAATGCCGGCAAATACATTTCTGTAATGGATAGCTCTTTGTTA
ACGTTTATGTTAGCGCGCGTTCGCAGGTGCGCCTGCGACCGATGCAACAATTCCATTCACTTTTGATCCCACCGC
GGATTTCCATGGTGTGTATAATTCAATCATCAATGCTGAGGTTGTACCATGAAGCTCATATAAATATGCAGAGTA
TCGTATTGATGTGAGCTCTCATCTTGTAACCAAAAAAGCCTACTCAATTATGAACTATGCAGTGGTCGTCTGACG
CCACAGCATTCTATATCGATGGACAACGGAAGGCTCGCTTCACGCAGAATGTAAAATATCTTCTTAGATCACTCT
ACCAACACAAGCTTACCGAATTTGTATCTAGGTTCCGACGCAAGCGGGTCATTGGATTTGGAATGTATGGAGCAG
TGGAGATCCTTGCTGGTCGAACGGTCCTCCGACGGCGGACTCTATAACTCAAATTCGGTCAATTGAAATGTTCAC
AGGATGGACTTCAACGGTCTCCGGGAATGTGTGCAGCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail