Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040570
Gene name
Locationscaffold_02:470214..472755
Strand-
Gene length (bp)2541
Transcript length (bp)2139
Coding sequence length (bp)2139
Protein length (aa) 713

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05346 DUF747 Eukaryotic membrane protein family 1.4E-112 263 632

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 181 677 3.0E-95
sp|Q4VBD2|TAPT1_MOUSE Transmembrane anterior posterior transformation protein 1 OS=Mus musculus GN=Tapt1 PE=1 SV=2 181 561 1.0E-77
sp|Q6NXT6|TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens GN=TAPT1 PE=1 SV=1 181 561 2.0E-77
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 169 561 1.0E-76
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 181 552 3.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 181 677 3.0E-95
sp|Q4VBD2|TAPT1_MOUSE Transmembrane anterior posterior transformation protein 1 OS=Mus musculus GN=Tapt1 PE=1 SV=2 181 561 1.0E-77
sp|Q6NXT6|TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens GN=TAPT1 PE=1 SV=1 181 561 2.0E-77
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 169 561 1.0E-76
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 181 552 3.0E-75
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 168 561 1.0E-70
sp|Q9VED0|TAPT1_DROME Protein TAPT1 homolog OS=Drosophila melanogaster GN=CG7218 PE=2 SV=2 181 552 8.0E-70
sp|A2BIE7|TAPT1_DANRE Transmembrane anterior posterior transformation protein 1 homolog OS=Danio rerio GN=tapt1 PE=3 SV=1 181 542 2.0E-64
sp|Q9U3H8|TAPT1_CAEEL Protein TAPT1 homolog OS=Caenorhabditis elegans GN=F26F2.7 PE=3 SV=1 156 561 5.0E-62
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 204 568 1.0E-59
sp|F4HVJ3|POD1_ARATH Protein POLLEN DEFECTIVE IN GUIDANCE 1 OS=Arabidopsis thaliana GN=POD1 PE=1 SV=1 199 510 4.0E-49
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 232 254 22
2 267 286 19
3 351 373 22
4 541 563 22
5 603 625 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040570
MTTSPPQKPKKLHRRFSSGSHDILTIITNQGQSRTRDKPALQTSPSAPLVQKPGLQKRDFSLPEQRPTHTHERTY
STDGSDVDVGTDWVQRERAHRPQLNGLTNGSLPGNLGFQGGRHSPPTAYASLPATPRLESFEDKADPPSLKMPLS
ASLQVPILDPPTSRRQHAREDSKVYGPPPFSIWDYLREELLATDFDSHQELKWERVSNFLNIPVAVEKIIGFGFF
LCLDSFLYTFTVLPIRFSLAFIRLIVNLFRRSASPLPPSQKADLLRALLLVISVIVLVPMTDASKIYHKIRGQDT
IKLYVIFNALEIADRLCSSIGQDILDCLFSRSTLVPLSHKIPVTANTLTPFLYFFLALAYVLSHTLVMVYQLISL
NVAINSYEYALLTLLVSNQFVEIKGSVFKKFEKDTLFQITCADVVERFNLALMLAVVAFRNLIELSGSDFDFAGG
YVLPKSFGWFRGNNVLWTISYPVLTVLCSEMLVDWLKHAFITKFNHIRPSVYERYTDVLCLDLASASAVNRKGAR
KHSYADQAPLVARRLGFASLPLAVMVILLGSQSISLLFSDLQPLPYSFWNLLSIYNLDLNTLSLSLRSAEVVKYI
TLGVMGVLFWLCFVVIKVIIGVNLLTYATRRQAGMDEREAMDIVNNFGRDPIGEGNDERKYNKNLKKYLDDDEDD
APRLPDMGEIRPGQEMNKKERVKLEDLTRFTMVKRIY*
Coding >Agabi119p4|040570
ATGACGACATCTCCGCCCCAAAAGCCCAAGAAATTGCATCGACGCTTTTCCTCTGGCAGCCACGACATTCTTACG
ATTATAACTAATCAAGGCCAATCCAGGACCCGGGACAAACCTGCTCTCCAAACTTCTCCTTCCGCTCCACTCGTA
CAAAAGCCCGGTCTGCAAAAGCGGGATTTCTCACTGCCAGAACAACGGCCTACGCACACACATGAACGAACGTAT
TCTACCGACGGGTCTGATGTAGATGTAGGTACAGATTGGGTGCAGAGAGAAAGGGCGCACAGGCCACAGTTGAAC
GGCTTGACAAATGGCAGTCTTCCTGGTAATTTGGGTTTTCAAGGCGGACGTCACAGTCCCCCAACGGCGTATGCA
TCGTTACCAGCAACCCCGCGCCTAGAGTCGTTCGAAGACAAAGCAGACCCTCCTTCACTGAAGATGCCTCTCTCG
GCGAGCCTACAAGTGCCAATATTAGACCCACCTACCTCGCGGCGCCAACATGCCAGAGAAGATAGTAAAGTGTAT
GGACCTCCACCTTTCTCAATATGGGATTACCTCCGGGAAGAACTTTTGGCGACGGATTTCGATTCGCACCAAGAG
TTGAAGTGGGAACGTGTCAGCAATTTCCTAAACATACCTGTGGCCGTGGAAAAAATCATTGGCTTTGGTTTTTTC
CTATGCTTGGATAGTTTCTTGTACACCTTTACCGTTCTTCCCATCCGTTTCAGTCTCGCCTTCATCCGCCTCATT
GTTAATTTATTCCGGAGATCTGCATCTCCCCTTCCCCCATCGCAGAAAGCCGATCTGCTCAGAGCGTTATTACTC
GTCATCTCGGTAATTGTGCTGGTACCGATGACAGATGCGAGCAAAATTTATCACAAAATTCGTGGTCAGGATACT
ATTAAGTTATATGTTATATTCAATGCACTAGAGATTGCGGATAGGCTCTGCTCCTCCATAGGCCAGGATATCCTT
GATTGTTTGTTCTCGCGCTCGACGCTCGTACCACTTTCTCATAAAATTCCTGTCACGGCGAATACGCTCACACCT
TTCCTGTACTTCTTTCTTGCGCTTGCATACGTTTTGTCTCACACTCTAGTCATGGTATATCAACTGATCTCTCTC
AATGTTGCCATCAATTCGTATGAATACGCTCTATTGACGCTTCTTGTATCCAACCAATTCGTCGAGATCAAGGGC
AGTGTCTTCAAGAAGTTTGAAAAAGATACCCTTTTCCAGATAACGTGTGCTGATGTCGTTGAACGGTTCAACCTT
GCTTTAATGCTTGCAGTCGTAGCATTCAGAAATCTCATAGAGCTCAGTGGCTCCGATTTTGATTTTGCTGGAGGT
TATGTTCTACCCAAGAGTTTCGGTTGGTTCAGGGGAAACAACGTTCTGTGGACCATATCTTATCCCGTGCTCACT
GTGCTGTGCTCTGAAATGCTTGTCGACTGGTTGAAGCACGCCTTCATTACGAAGTTCAACCACATTCGGCCGTCA
GTTTATGAGCGCTATACAGACGTCTTGTGTCTCGACCTAGCTAGTGCTAGTGCTGTCAATAGAAAAGGCGCCAGA
AAGCACTCGTATGCTGACCAAGCCCCACTCGTGGCCCGCCGGCTTGGATTTGCTTCGTTACCCCTTGCAGTTATG
GTGATCCTTCTGGGATCTCAGTCGATTAGTCTATTGTTTTCCGATCTCCAACCTCTACCATATTCCTTCTGGAAT
CTGCTGTCAATCTATAATCTCGATCTCAACACCCTTTCGCTATCGCTCCGAAGCGCTGAGGTAGTCAAGTACATA
ACTCTGGGTGTAATGGGCGTGTTGTTTTGGTTGTGTTTTGTGGTCATCAAGGTCATTATTGGCGTGAATTTACTA
ACTTATGCCACCCGAAGGCAGGCTGGTATGGATGAACGGGAAGCAATGGACATTGTTAATAATTTCGGTCGCGAT
CCCATAGGGGAAGGGAATGATGAACGAAAATACAATAAGAATCTGAAGAAGTATTTGGATGACGACGAAGACGAT
GCTCCACGGCTGCCGGACATGGGCGAAATTCGGCCAGGTCAAGAGATGAATAAGAAGGAAAGAGTGAAATTAGAG
GATCTGACGAGGTTTACGATGGTGAAGCGAATTTATTAG
Transcript >Agabi119p4|040570
ATGACGACATCTCCGCCCCAAAAGCCCAAGAAATTGCATCGACGCTTTTCCTCTGGCAGCCACGACATTCTTACG
ATTATAACTAATCAAGGCCAATCCAGGACCCGGGACAAACCTGCTCTCCAAACTTCTCCTTCCGCTCCACTCGTA
CAAAAGCCCGGTCTGCAAAAGCGGGATTTCTCACTGCCAGAACAACGGCCTACGCACACACATGAACGAACGTAT
TCTACCGACGGGTCTGATGTAGATGTAGGTACAGATTGGGTGCAGAGAGAAAGGGCGCACAGGCCACAGTTGAAC
GGCTTGACAAATGGCAGTCTTCCTGGTAATTTGGGTTTTCAAGGCGGACGTCACAGTCCCCCAACGGCGTATGCA
TCGTTACCAGCAACCCCGCGCCTAGAGTCGTTCGAAGACAAAGCAGACCCTCCTTCACTGAAGATGCCTCTCTCG
GCGAGCCTACAAGTGCCAATATTAGACCCACCTACCTCGCGGCGCCAACATGCCAGAGAAGATAGTAAAGTGTAT
GGACCTCCACCTTTCTCAATATGGGATTACCTCCGGGAAGAACTTTTGGCGACGGATTTCGATTCGCACCAAGAG
TTGAAGTGGGAACGTGTCAGCAATTTCCTAAACATACCTGTGGCCGTGGAAAAAATCATTGGCTTTGGTTTTTTC
CTATGCTTGGATAGTTTCTTGTACACCTTTACCGTTCTTCCCATCCGTTTCAGTCTCGCCTTCATCCGCCTCATT
GTTAATTTATTCCGGAGATCTGCATCTCCCCTTCCCCCATCGCAGAAAGCCGATCTGCTCAGAGCGTTATTACTC
GTCATCTCGGTAATTGTGCTGGTACCGATGACAGATGCGAGCAAAATTTATCACAAAATTCGTGGTCAGGATACT
ATTAAGTTATATGTTATATTCAATGCACTAGAGATTGCGGATAGGCTCTGCTCCTCCATAGGCCAGGATATCCTT
GATTGTTTGTTCTCGCGCTCGACGCTCGTACCACTTTCTCATAAAATTCCTGTCACGGCGAATACGCTCACACCT
TTCCTGTACTTCTTTCTTGCGCTTGCATACGTTTTGTCTCACACTCTAGTCATGGTATATCAACTGATCTCTCTC
AATGTTGCCATCAATTCGTATGAATACGCTCTATTGACGCTTCTTGTATCCAACCAATTCGTCGAGATCAAGGGC
AGTGTCTTCAAGAAGTTTGAAAAAGATACCCTTTTCCAGATAACGTGTGCTGATGTCGTTGAACGGTTCAACCTT
GCTTTAATGCTTGCAGTCGTAGCATTCAGAAATCTCATAGAGCTCAGTGGCTCCGATTTTGATTTTGCTGGAGGT
TATGTTCTACCCAAGAGTTTCGGTTGGTTCAGGGGAAACAACGTTCTGTGGACCATATCTTATCCCGTGCTCACT
GTGCTGTGCTCTGAAATGCTTGTCGACTGGTTGAAGCACGCCTTCATTACGAAGTTCAACCACATTCGGCCGTCA
GTTTATGAGCGCTATACAGACGTCTTGTGTCTCGACCTAGCTAGTGCTAGTGCTGTCAATAGAAAAGGCGCCAGA
AAGCACTCGTATGCTGACCAAGCCCCACTCGTGGCCCGCCGGCTTGGATTTGCTTCGTTACCCCTTGCAGTTATG
GTGATCCTTCTGGGATCTCAGTCGATTAGTCTATTGTTTTCCGATCTCCAACCTCTACCATATTCCTTCTGGAAT
CTGCTGTCAATCTATAATCTCGATCTCAACACCCTTTCGCTATCGCTCCGAAGCGCTGAGGTAGTCAAGTACATA
ACTCTGGGTGTAATGGGCGTGTTGTTTTGGTTGTGTTTTGTGGTCATCAAGGTCATTATTGGCGTGAATTTACTA
ACTTATGCCACCCGAAGGCAGGCTGGTATGGATGAACGGGAAGCAATGGACATTGTTAATAATTTCGGTCGCGAT
CCCATAGGGGAAGGGAATGATGAACGAAAATACAATAAGAATCTGAAGAAGTATTTGGATGACGACGAAGACGAT
GCTCCACGGCTGCCGGACATGGGCGAAATTCGGCCAGGTCAAGAGATGAATAAGAAGGAAAGAGTGAAATTAGAG
GATCTGACGAGGTTTACGATGGTGAAGCGAATTTATTAG
Gene >Agabi119p4|040570
ATGACGACATCTCCGCCCCAAAAGCCCAAGAAATTGCATCGACGCTTTTCCTCTGGCAGCCACGACATTCTTACG
ATTATAACTAATCAAGGCCAATCCAGGACCCGGGACAAACCTGCTCTCCAAACTTCTCCTTCCGCTCCACTCGTA
CAAAAGCCCGGTCTGCAAAAGCGGGATTTCTCACTGCCAGAACAACGGCCTACGCACACACATGAACGAACGTAT
TCTACCGACGGGTCTGATGTAGATGTAGGTACAGATTGGGTGCAGAGAGAAAGGGCGCACAGGCCACAGTTGAAC
GGCTTGACAAATGGCAGTCTTCCTGGTAATTTGGGTTTTCAAGGCGGACGTCACAGTCCCCCAACGGCGTATGCA
TCGTTACCAGCAACCCCGCGCCTAGAGTCGTTCGAAGACAAAGCAGACCCTCCTTCACTGAAGATGCCTCTCTCG
GCGAGCCTACAAGTGCCAATATTAGACCCACCTACCTCGCGGCGCCAACATGCCAGAGAAGATAGTAAAGTGTAT
GGACCTCCACCTTTCTCAATATGGGATTACCTCCGGGAAGAACTTTTGGCGACGGATTTCGATTCGCACCAAGAG
TTGAAGTGGGAACGTGTCAGCAATTTCCTAAACATACCTGTGGCCGTGGAAAAAGTATGTTGACCCAAATCACAT
ATTCAATCAGCCGTTTCTTGACCACGGTGCTTAGATCATTGGCTTTGGTTTTTTCCTATGCTTGGATAGTTTCTT
GTACACCTTTACCGTTCTTCCCATCCGTTTCAGTCTCGCCTTCATCCGCCTCATTGTTAATTTATTCCGGAGATC
TGCATCTCCCCTTCCCCCATCGCAGAAAGCCGATCTGCTCAGAGCGTTATTACTCGTCATCTCGGTAATTGTGCT
GGTACCGATGACAGATGCGAGCAAAATTTATCACAAAATTCGTGGTCAGGATACTATTAAGTTATATGTTATATT
CAATGCACTAGAGGTGAGTTTGGACGTCATTCCCATCCAACTTTTGATTGACTGGATCTTGAGATTGCGGATAGG
CTCTGCTCCTCCATAGGCCAGGATATCCTTGATTGTTTGTTCTCGCGCTCGACGCTCGTACCACTTTCTCATAAA
ATTCCTGTCACGGCGAATACGCTCACACCTTTCCTGTACTTCTTTCTTGCGCTTGCATACGTTTGTGGGTCGAGC
GCTTTATTTTTTGATCCAATTTGCTGACTCTATTTAGTGTCTCACACTCTAGTCATGGTATATCAACTGATCTCT
CTCAATGTTGCCATCAATTCGTATGAATACGCTCTATTGACGCTTCTTGTATCCAACCAATTCGTCGAGATCAAG
GGCAGTGTCTTCAAGAAGTTTGAAAAAGATACCCTTTTCCAGATAACGTGTGCTGGTAAGGATGAACAGTTTTTC
ACAAGCTCATACTCAAGTGACTTTCTTTAGATGTCGTTGAACGGTTCAACCTTGCTTTAATGCTTGCAGTCGTAG
CATTCAGAAATCTCATAGAGCTCAGTGGCTCCGATTTTGATTTTGCTGGAGGTTATGTTCTACCCAAGAGTTTCG
GTTGGTTCAGGGGAAACAACGTTCTGTGGACCATATCTTATGTGAGTGATCAAATTTCCCGCCTTTGTACAGTTC
TCTACCATTTTATTACAGCCCGTGCTCACTGTGCTGTGCTCTGAAATGCTTGTCGACTGGTTGAAGCACGCCTTC
ATTACGAAGTTCAACCACATTCGGCCGTCAGTTTATGAGCGCTATACAGACGTCTTGTGTCTCGACCTAGCTAGT
GCTAGTGCTGTCAATAGAAAAGGCGCCAGAAAGGTGATTAAATATTTGCCACTTGTTAAACCCCAACTTATCGTA
GATTTAGCACTCGTATGCTGACCAAGCCCCACTCGTGGCCCGCCGGCTTGGATTTGCTTCGTTACCCCTTGCAGT
TATGGTGATCCTTCTGGGATCTCAGTCGATTAGTCTATTGTTTTCCGATCTCCAACCTCTACCATATTCCTTCTG
GAATCTGCTGTCAATCTATAATCTCGATCTCAACACCCTTTCGCTATCGCTCCGAAGCGCTGAGGTAGTCAAGTA
CATAACTCTGGGTGTAATGGGCGTGTTGTTTTGGTTGTGGTATGATCAGCACCTGTCCGATGTTATACCACTCAC
TACTCTGTGATAGTTTTGTGGTCATCAAGGTCATTATTGGCGTGAATTTACTAACTTATGCCACCCGAAGGCAGG
CTGGTATGGATGAACGGGAAGCAATGGACATTGTTAATAATTTCGGTCGCGATCCCATAGGGGAAGGGAATGATG
AACGAGTGAGTGTTCTATGCTTTGGCCACGGCTTTCTATGCTGAAATTCTGTAGAAATACAATAAGAATCTGAAG
AAGTATTTGGATGACGACGAAGACGATGCTCCACGGCTGCCGGACATGGGCGAAATTCGGCCAGGTCAAGAGATG
AATAAGAAGGAAAGAGTGAAATTAGAGGATCTGACGAGGTTTACGATGGTGAAGCGAATTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail