Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040480
Gene name
Locationscaffold_02:438456..442767
Strand+
Gene length (bp)4311
Transcript length (bp)3387
Coding sequence length (bp)3387
Protein length (aa) 1129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 4.0E-05 888 977

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04336|YM54_YEAST Uncharacterized protein YMR196W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR196W PE=1 SV=1 121 1080 0.0E+00

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040480
MTSSSVKEVQQKIFGTGVVESKATQEVERSGSPQTPTASPVGQGTGLTLIIPTPKPVPSPLPRKPTSDQSPKAAI
AGSRGETGEEDAVTGAEVEEYGDKEESSVPFRTRLAQKLGPEYEGAERYRLQQDDKKENHWKRWGPYLSDRQWAT
VREDYSANGDAWSHFPHEHARSRAYRWGEDGIAGISDNHQRLCFALSFWNGEDPILKERLFGVTGHQGNHGEDVK
ELYYYLDSTPTHSYMKFLYKYPQKRYPYEELVRENQRRDRTVSEFEILDTDAFEEDRYWDVFVEYAKDENRPDNI
SIRITAYNRGPDPATLHVIPQLWFPNTWSWPLETPPKPNLTGSVRGKDKTSTITARHPTLGKTHLHCLPSPPPVG
PTNEFDSTSGIDSVDPELLFTENDTNFSRLYGGTNQTLYVKDAFHDHIIASHRPPVHDSEKEDTFIQRIRPRSLH
GASECNSPEEGPCTPFPPTQSYVNMNMEGTKSAAHYTFDNVPGGGCAVVRLKLTPSRIGSDPSLEDEVLFDDTIE
ERRQEADEFYNALGLGMISEDLKQVMRQALGGMLWTKQYYRFIQKEWLEGDPAQPAPPPERKHIRNQHWRHLHIE
DVLSMPDKWEYPFFAAWDTAFHCIPLAVVDPSFAKKQLDLLTREWYMKPDGQIPAYEWNFSDVNPPVHAWATFRV
FKIERKLHGREDLPFLERVFQKLLLNFTWWVNRKDQDGKNVFEGGFLGLDNIGVFNRSEPLPTGGTLRQADGTAW
MAFYCLNMLNMALELAKHNAVYEDIASKFFEHFIFIADAMTFKEGDQENSLWNEKDGMYYDVIDFGNGGSKQLPV
RSLVGLMPLYATLVLEPATINRFPGFKKRMEWFIDNRSQMANRNMANMKVVGKDQRRLLALASKERLVMILEKML
DEDEFLSEHGIRSLSKLHKEHPWGMEVHGNHYEVPYWPGDSLSGMFGGNSNWRGPIWLATNFLLIESLQRFYQYY
GDDLQVECPTGSGFYMNLASVAEEIQHRIIHIFGRDVEGRRATNGGSTKLDYDPHFRDYVWFYEFFHADTGKGLG
ASHQTGWSGLVAYHILQSGVTCRLPRTPKTPRSVVHHYFDETIDPQSAVDHDEPPKSAYSMFSSSEIRTLYDISP
DAL*
Coding >Agabi119p4|040480
ATGACCAGCTCTAGCGTCAAGGAAGTACAGCAGAAGATATTCGGGACCGGGGTGGTGGAGAGTAAAGCTACTCAG
GAAGTTGAGAGATCTGGATCTCCTCAGACACCTACTGCTTCTCCCGTGGGACAAGGCACTGGATTGACTCTTATC
ATCCCAACGCCAAAACCAGTTCCTTCTCCTCTGCCAAGAAAACCCACATCAGATCAATCACCCAAGGCTGCTATT
GCTGGATCTAGAGGGGAGACGGGTGAAGAAGACGCGGTCACTGGTGCCGAAGTTGAAGAATACGGTGACAAAGAA
GAATCTAGTGTGCCTTTTAGAACAAGATTGGCGCAAAAATTAGGGCCTGAGTATGAGGGTGCCGAGAGATATCGA
TTGCAACAAGATGACAAGAAAGAGAATCATTGGAAGAGATGGGGTCCGTATCTGAGCGACCGACAATGGGCAACT
GTAAGGGAAGATTATTCCGCGAATGGAGACGCTTGGAGTCACTTCCCGCATGAACATGCGCGATCGAGAGCGTAT
CGCTGGGGTGAAGACGGTATCGCGGGTATCTCTGATAACCACCAGCGTTTATGCTTCGCGCTTTCATTCTGGAAT
GGCGAGGATCCTATACTCAAAGAAAGATTGTTCGGCGTAACCGGACATCAAGGAAATCATGGTGAGGATGTCAAG
GAGTTGTATTACTACCTCGACTCGACGCCGACACACTCGTATATGAAATTCTTGTACAAATATCCGCAAAAGAGG
TATCCTTATGAGGAGCTGGTCAGAGAGAACCAGCGTAGGGACCGAACAGTCTCTGAGTTTGAAATTCTAGATACT
GATGCATTTGAAGAAGATCGCTATTGGGATGTTTTCGTCGAGTATGCTAAAGACGAAAACCGTCCAGATAACATC
AGCATCCGCATTACAGCTTACAACCGCGGACCCGACCCCGCGACACTCCACGTTATACCCCAGCTGTGGTTTCCA
AATACCTGGTCATGGCCGCTGGAGACACCTCCCAAGCCCAACCTGACTGGCTCAGTGCGGGGGAAGGATAAAACA
AGCACCATCACTGCTCGCCATCCTACTCTTGGCAAGACTCATCTCCATTGTTTACCTTCACCTCCCCCTGTCGGG
CCCACGAATGAATTTGATAGCACTTCTGGGATAGACTCAGTAGATCCGGAGCTTCTCTTTACCGAAAACGATACC
AACTTCAGCCGACTTTATGGTGGAACCAATCAAACTCTATATGTCAAGGACGCTTTCCATGATCATATCATAGCG
AGCCATAGGCCCCCCGTTCATGATTCTGAAAAGGAGGACACCTTTATCCAAAGAATCCGTCCTCGATCCCTTCAT
GGGGCCTCGGAATGTAATTCTCCTGAAGAAGGTCCCTGCACGCCTTTCCCTCCTACGCAGTCCTACGTCAATATG
AATATGGAGGGCACCAAGTCTGCCGCACACTACACCTTTGATAATGTACCCGGGGGTGGATGTGCTGTCGTGCGC
TTGAAGCTAACCCCTTCTCGAATTGGTAGCGACCCCAGTTTAGAGGATGAAGTACTGTTCGATGATACGATCGAA
GAGCGCAGGCAAGAGGCTGACGAATTTTATAACGCCCTCGGACTTGGTATGATTAGCGAAGATTTGAAGCAGGTT
ATGCGGCAGGCGCTGGGTGGCATGTTATGGACTAAGCAGTATTACCGATTTATTCAGAAGGAGTGGTTAGAAGGT
GATCCGGCCCAACCTGCTCCTCCACCCGAACGGAAACATATCAGGAATCAACATTGGCGTCACCTACATATCGAA
GATGTACTTTCGATGCCCGATAAGTGGGAATATCCCTTTTTCGCCGCTTGGGACACTGCTTTCCATTGTATACCA
TTGGCCGTTGTCGACCCTTCGTTTGCCAAGAAACAGCTAGATCTCTTGACACGGGAGTGGTATATGAAACCCGAC
GGGCAAATCCCGGCCTACGAGTGGAATTTTAGCGATGTCAATCCTCCAGTGCATGCCTGGGCTACATTCCGAGTC
TTCAAAATTGAACGTAAGTTGCACGGGCGAGAGGATCTTCCTTTCCTTGAACGTGTTTTCCAAAAGTTACTTTTG
AACTTCACATGGTGGGTCAATCGGAAAGACCAAGATGGAAAAAACGTGTTCGAAGGAGGCTTCTTGGGATTAGAT
AACATCGGAGTATTCAATCGCTCAGAACCGCTTCCCACTGGTGGAACCCTCCGTCAGGCCGATGGGACTGCATGG
ATGGCATTCTATTGTTTGAACATGCTTAACATGGCTTTAGAATTGGCGAAGCACAATGCCGTGTACGAAGATATT
GCTTCCAAATTTTTCGAGCATTTTATTTTCATCGCGGATGCTATGACGTTCAAGGAAGGCGATCAAGAAAACAGC
CTGTGGAACGAGAAAGATGGAATGTATTACGATGTCATAGATTTTGGAAACGGAGGTTCCAAGCAGCTACCCGTA
AGAAGCTTGGTTGGACTCATGCCTCTCTATGCGACGCTAGTGCTCGAACCGGCCACAATAAACCGATTCCCTGGA
TTCAAAAAGCGGATGGAGTGGTTCATAGACAATAGGTCACAAATGGCGAATAGGAATATGGCGAATATGAAAGTT
GTTGGAAAGGACCAGCGCAGATTGTTAGCCTTGGCAAGCAAGGAGAGGCTTGTTATGATCCTGGAAAAAATGCTG
GACGAGGATGAATTCCTCAGCGAGCACGGTATTCGATCATTATCGAAGCTTCACAAAGAGCACCCGTGGGGGATG
GAGGTCCACGGAAATCATTACGAAGTTCCCTATTGGCCTGGCGATTCACTCTCAGGGATGTTTGGTGGTAATTCA
AACTGGAGAGGACCAATTTGGCTTGCTACCAACTTTTTGCTCATCGAAAGTCTTCAGCGTTTCTACCAGTACTAT
GGCGACGATCTTCAGGTTGAATGTCCCACCGGTAGTGGGTTTTACATGAATCTTGCTTCAGTAGCAGAAGAGATC
CAACATCGCATCATCCATATCTTCGGTCGGGATGTGGAGGGTCGCCGAGCCACTAATGGAGGCAGCACAAAATTA
GACTACGATCCTCACTTCCGTGACTATGTTTGGTTCTACGAATTCTTCCACGCAGACACTGGAAAAGGGTTAGGT
GCCTCTCACCAAACAGGGTGGTCGGGCCTAGTAGCATATCATATTCTTCAAAGCGGAGTGACCTGTCGATTGCCG
AGGACACCCAAAACTCCTCGCAGCGTTGTCCATCATTACTTTGACGAAACTATTGATCCCCAGTCCGCAGTTGAT
CATGATGAGCCACCTAAGTCGGCTTATAGCATGTTTAGCTCCAGCGAAATCCGCACTCTTTATGACATCTCGCCT
GACGCACTTTAA
Transcript >Agabi119p4|040480
ATGACCAGCTCTAGCGTCAAGGAAGTACAGCAGAAGATATTCGGGACCGGGGTGGTGGAGAGTAAAGCTACTCAG
GAAGTTGAGAGATCTGGATCTCCTCAGACACCTACTGCTTCTCCCGTGGGACAAGGCACTGGATTGACTCTTATC
ATCCCAACGCCAAAACCAGTTCCTTCTCCTCTGCCAAGAAAACCCACATCAGATCAATCACCCAAGGCTGCTATT
GCTGGATCTAGAGGGGAGACGGGTGAAGAAGACGCGGTCACTGGTGCCGAAGTTGAAGAATACGGTGACAAAGAA
GAATCTAGTGTGCCTTTTAGAACAAGATTGGCGCAAAAATTAGGGCCTGAGTATGAGGGTGCCGAGAGATATCGA
TTGCAACAAGATGACAAGAAAGAGAATCATTGGAAGAGATGGGGTCCGTATCTGAGCGACCGACAATGGGCAACT
GTAAGGGAAGATTATTCCGCGAATGGAGACGCTTGGAGTCACTTCCCGCATGAACATGCGCGATCGAGAGCGTAT
CGCTGGGGTGAAGACGGTATCGCGGGTATCTCTGATAACCACCAGCGTTTATGCTTCGCGCTTTCATTCTGGAAT
GGCGAGGATCCTATACTCAAAGAAAGATTGTTCGGCGTAACCGGACATCAAGGAAATCATGGTGAGGATGTCAAG
GAGTTGTATTACTACCTCGACTCGACGCCGACACACTCGTATATGAAATTCTTGTACAAATATCCGCAAAAGAGG
TATCCTTATGAGGAGCTGGTCAGAGAGAACCAGCGTAGGGACCGAACAGTCTCTGAGTTTGAAATTCTAGATACT
GATGCATTTGAAGAAGATCGCTATTGGGATGTTTTCGTCGAGTATGCTAAAGACGAAAACCGTCCAGATAACATC
AGCATCCGCATTACAGCTTACAACCGCGGACCCGACCCCGCGACACTCCACGTTATACCCCAGCTGTGGTTTCCA
AATACCTGGTCATGGCCGCTGGAGACACCTCCCAAGCCCAACCTGACTGGCTCAGTGCGGGGGAAGGATAAAACA
AGCACCATCACTGCTCGCCATCCTACTCTTGGCAAGACTCATCTCCATTGTTTACCTTCACCTCCCCCTGTCGGG
CCCACGAATGAATTTGATAGCACTTCTGGGATAGACTCAGTAGATCCGGAGCTTCTCTTTACCGAAAACGATACC
AACTTCAGCCGACTTTATGGTGGAACCAATCAAACTCTATATGTCAAGGACGCTTTCCATGATCATATCATAGCG
AGCCATAGGCCCCCCGTTCATGATTCTGAAAAGGAGGACACCTTTATCCAAAGAATCCGTCCTCGATCCCTTCAT
GGGGCCTCGGAATGTAATTCTCCTGAAGAAGGTCCCTGCACGCCTTTCCCTCCTACGCAGTCCTACGTCAATATG
AATATGGAGGGCACCAAGTCTGCCGCACACTACACCTTTGATAATGTACCCGGGGGTGGATGTGCTGTCGTGCGC
TTGAAGCTAACCCCTTCTCGAATTGGTAGCGACCCCAGTTTAGAGGATGAAGTACTGTTCGATGATACGATCGAA
GAGCGCAGGCAAGAGGCTGACGAATTTTATAACGCCCTCGGACTTGGTATGATTAGCGAAGATTTGAAGCAGGTT
ATGCGGCAGGCGCTGGGTGGCATGTTATGGACTAAGCAGTATTACCGATTTATTCAGAAGGAGTGGTTAGAAGGT
GATCCGGCCCAACCTGCTCCTCCACCCGAACGGAAACATATCAGGAATCAACATTGGCGTCACCTACATATCGAA
GATGTACTTTCGATGCCCGATAAGTGGGAATATCCCTTTTTCGCCGCTTGGGACACTGCTTTCCATTGTATACCA
TTGGCCGTTGTCGACCCTTCGTTTGCCAAGAAACAGCTAGATCTCTTGACACGGGAGTGGTATATGAAACCCGAC
GGGCAAATCCCGGCCTACGAGTGGAATTTTAGCGATGTCAATCCTCCAGTGCATGCCTGGGCTACATTCCGAGTC
TTCAAAATTGAACGTAAGTTGCACGGGCGAGAGGATCTTCCTTTCCTTGAACGTGTTTTCCAAAAGTTACTTTTG
AACTTCACATGGTGGGTCAATCGGAAAGACCAAGATGGAAAAAACGTGTTCGAAGGAGGCTTCTTGGGATTAGAT
AACATCGGAGTATTCAATCGCTCAGAACCGCTTCCCACTGGTGGAACCCTCCGTCAGGCCGATGGGACTGCATGG
ATGGCATTCTATTGTTTGAACATGCTTAACATGGCTTTAGAATTGGCGAAGCACAATGCCGTGTACGAAGATATT
GCTTCCAAATTTTTCGAGCATTTTATTTTCATCGCGGATGCTATGACGTTCAAGGAAGGCGATCAAGAAAACAGC
CTGTGGAACGAGAAAGATGGAATGTATTACGATGTCATAGATTTTGGAAACGGAGGTTCCAAGCAGCTACCCGTA
AGAAGCTTGGTTGGACTCATGCCTCTCTATGCGACGCTAGTGCTCGAACCGGCCACAATAAACCGATTCCCTGGA
TTCAAAAAGCGGATGGAGTGGTTCATAGACAATAGGTCACAAATGGCGAATAGGAATATGGCGAATATGAAAGTT
GTTGGAAAGGACCAGCGCAGATTGTTAGCCTTGGCAAGCAAGGAGAGGCTTGTTATGATCCTGGAAAAAATGCTG
GACGAGGATGAATTCCTCAGCGAGCACGGTATTCGATCATTATCGAAGCTTCACAAAGAGCACCCGTGGGGGATG
GAGGTCCACGGAAATCATTACGAAGTTCCCTATTGGCCTGGCGATTCACTCTCAGGGATGTTTGGTGGTAATTCA
AACTGGAGAGGACCAATTTGGCTTGCTACCAACTTTTTGCTCATCGAAAGTCTTCAGCGTTTCTACCAGTACTAT
GGCGACGATCTTCAGGTTGAATGTCCCACCGGTAGTGGGTTTTACATGAATCTTGCTTCAGTAGCAGAAGAGATC
CAACATCGCATCATCCATATCTTCGGTCGGGATGTGGAGGGTCGCCGAGCCACTAATGGAGGCAGCACAAAATTA
GACTACGATCCTCACTTCCGTGACTATGTTTGGTTCTACGAATTCTTCCACGCAGACACTGGAAAAGGGTTAGGT
GCCTCTCACCAAACAGGGTGGTCGGGCCTAGTAGCATATCATATTCTTCAAAGCGGAGTGACCTGTCGATTGCCG
AGGACACCCAAAACTCCTCGCAGCGTTGTCCATCATTACTTTGACGAAACTATTGATCCCCAGTCCGCAGTTGAT
CATGATGAGCCACCTAAGTCGGCTTATAGCATGTTTAGCTCCAGCGAAATCCGCACTCTTTATGACATCTCGCCT
GACGCACTTTAA
Gene >Agabi119p4|040480
ATGACCAGCTCTAGCGTCAAGGAAGTACAGCAGAAGATATTCGGGACCGGGGTGGTGGAGAGTAAAGCTACTCAG
GAAGTTGAGAGATCTGGATCTCCTCAGACACCTACTGCTTCTCCCGTGGGACAAGGCACTGGATTGACTCTTATC
ATCCCAACGCCAAAACCAGTTCCTTCTCCTCTGCCAAGAAAACCCACATCAGATCAATCACCCAAGGCTGCTATT
GCTGGATCTAGAGGGGAGACGGGTGAAGAAGACGCGGTCACTGGTGCCGAAGTTGAAGAATACGGTGACAAAGAA
GAATCTAGTGTGCCTTTTAGAACAAGATTGGCGCAAAAATTAGGGCCTGAGTATGAGGGTGCCGAGAGATATCGA
TTGCAACAAGATGACAAGAAAGAGAATCATTGGAAGAGATGGGGTCCGTATCTGAGCGACCGACAATGGGTAAGT
CTGCCTTCATAGCTTTGGAATCTTAGCCCTTTGAATTGTTCGTGGAAAGCTCATTCTTATTATAAGGCAACTGTA
AGGGAAGATTATTCCGCGAATGGAGACGCTTGGAGTCACTTCCCGCATGAACATGCGCGATCGAGAGCGTATCGC
TGGGGTGAAGACGGTATCGCGGGTATCTCTGATAACCACCAGCGTTTATGCTTCGCGCTTTCATTCTGGAATGGC
GAGGATCCTATACTCAAAGAAAGATTGTTCGGCGTAACCGGACATCAAGGAAATCATGGTGAGGATGTCAAGGAG
TTGTATTACTACCTCGACTCGACGCCGACACACTCGTATATGAAATTCTTGTACAAATATCCGCAAAAGAGGTAT
CCTTATGAGGAGCTGGTCAGAGAGAACCAGCGTAGGGACCGAACAGTCTCTGAGTTTGAAATTCTAGATACTGAT
GCATTTGAAGAAGATCGCTATTGGGATGTTTTCGTCGAGGTTTGTAATGCAATTTAACTATTGACTCTATTCCTG
ACTTGACTGTAGTATGCTAAAGACGAAAACCGTCCAGATAACATCAGCATCCGCATTACAGCTTACAACCGCGGA
CCCGACCCCGCGACACTCCACGTTATACCCCAGCTGTGGTTTCCAAATACCTGGTCATGGCCGCTGGAGACACCT
CCCAAGCCCAACCTGACTGGCTCAGTGCGGGGGAAGGATAAAACAAGCACCATCACTGCTCGCCATCCTACTCTT
GGCAAGACTCATCTCCATTGTTTACCTTCACCTCCCCCTGTCGGGCCCACGAATGAATTTGATAGCACTTCTGGG
ATAGACTCAGTAGATCCGGAGCTTCTCTTTACCGAAAACGATACCAACTTCAGCCGACTTTATGGTGGAACCAAT
CAAACTCTATATGTCAAGGACGCTTTCCATGATCATATCATAGCGAGCCATAGGCCCCCCGTTCATGATTCTGAA
AAGGAGGACACCTTTATCCAAAGAATCCGTCCTCGATCCCTTCATGGGGCCTCGGAATGTAATTCTCCTGAAGAA
GGTCCCTGCACGCCTTTCCCTCCTACGCAGTCCTACGTCAATATGAATATGGAGGGCACCAAGTCTGCCGCACAC
TACACCTTTGATAATGTACCCGGGGGTGGATGTGCTGTCGTGCGCTTGAAGCTAACCCCTTCTCGAATTGGTAGC
GACCCCAGTTTAGAGGATGAAGTACTGTTCGATGATACGATCGAAGAGCGCAGGCAAGAGGCTGACGAATTTTAT
AACGCCCTCGGACTTGGTATGATTAGCGAAGATTTGAAGCAGGTTATGCGGCAGGCGCTGGGTGGCATGTTATGG
ACTAAGCAGTATTACCGATTTATTCAGAAGGAGTGGTTAGAAGGTGATCCGGCCCAACCTGCTCCTCCACCCGAA
CGGAAACATATCAGGAATCAAGTAAGTTCACTCTTTATTATCCTTAAGCTTGTTTTCATGTCTTTTACTAGCATT
GGCGTCACCTACATATCGAAGATGTACTTTCGATGCCCGATAAGTAATATAATACTCTCATAATTAGTTGATTCC
ACCTAATCGTCTTTGGACAAATAGGTGGGAATATCCCTTTTTCGCCGCTTGGGACACTGCTTTCCATTGTATACC
ATTGGCCGTTGTCGACCCTTCGTTTGCCAAGAAACAGCTAGATCTCTTGACACGGGAGTGGTATATGAAACCCGA
CGGGCAAATCCCGGCCTACGAGTGGAATTTTAGCGATGTCAATCCTCCAGTGCATGCCTGGTAAGTCTAAGCAAT
GATATCATACATTACCCATTATTAACTGACATTGCAAGGGCTACATTCCGAGTCTTCAAAATTGAACGTAAGTTG
CACGGGCGAGAGGATCTTCCTTTCCTTGAACGTGTTTTCCAAAAGTTACTTTTGAACTTCACATGGTACGTTCGG
CAAATGATGTGCGACCACTTTCTAATAGGGTTTCTTTTAAGGTGGGTCAATCGGAAAGACCAAGATGGAAAAAAC
GTGTTCGAAGGAGGCTTCTTGGGATTAGATAACATCGGAGTATTCAATCGCTCAGAACCGCTTCCCACTGGTGGA
ACCCTCCGTCAGGCCGATGGGACTGCATGGATGGCATTCTATTGTTTGAACATGTAAGGTTCTAGACTTACCGAT
CCTCGCCACAGTATCCATTTATGTCTGGTTTTCTTTTTCTTTTTTCAGGCTTAACATGGCTTTAGAATTGGCGAA
GCACAATGCCGTGTACGAAGATATTGCTTCCAAATTTTTCGAGGTGAGTTAATTCCCGCTCCATGTGGGATCCCA
TGCAATTTTGAATCGGCTTCCTTCAATCTGTAACTTGATACTTTACCACGGATCTAGCATTTTATTTTCATCGCG
GATGCTATGACGTTCAAGGAAGGCGATCAAGAAAACAGCCTGTGGAACGAGAAAGATGGAATGTATTACGATGTC
ATAGATTTTGGAAACGGAGGTTCCAAGCAGCTACCCGTAAGAAGCTTGGTTGGACTCATGCCTCTCTATGCGACG
CTAGTGCTCGAACCGGCCACAATAAACCGATTCCCTGGATTCAAAAAGCGGATGGAGTGGTTCATAGACAATAGG
TCACAAATGGCGAATAGGAATATGGCGAATATGAAAGGTGAGAGATTGATGATATCATACTTCCTTAGTATATTG
AGGTTGCCGCAGTTGTTGGAAAGGACCAGCGCAGATTGTTAGCCTTGGCAAGCAAGGAGAGGCTTGTTATGATCC
TGGAAAAAATGCTGGACGAGGATGAATTCCTCAGCGAGCACGGTATTCGATCGTAAGCAAGGCCAATCGGTTGCA
AATCCCAAACTCATGTTTTCGAACTCAGATTATCGAAGCTTCACAAAGAGCACCCGTGGGGGATGGAGGTCCACG
GAAATCATTACGAAGTTCCCTATTGGCCTGGCGATTCACTCTCAGGGATGTTTGGTGGTAATTCAAACTGGAGAG
GACCAATTTGTGAGCCGTGATTTTCGCGTCTCGGGTGCATAAATTTACACGCTGTTCAGGGCTTGCTACCAACTT
TTTGCTCATCGAAAGTCTTCAGCGTTTCTACCAGTACTATGGCGACGATCTTCAGGTTGGTAAATTTGGCGCAAT
TCGCATTGTCATATGTCCCTGATGTATACCGTTCGGGTGAATTATTAGGTTGAATGTCCCACCGGTAGTGGGTTT
TACATGAATCTTGCTTCAGTAGCAGAAGAGATCCAACATCGCATCATCCATATCTTCGGTCGGGATGTGGAGGGT
CGCCGAGCCACTAATGGAGGCAGCACAAAATTAGACTACGATCCTCACTTCCGTGACTATGTTTGGTTCTACGAA
GTACGGTCCTTGTTTGTAGCCTCTAAAGTTCCCCACCTGATGCTTGATAGTTCTTCCACGCAGACACTGGAAAAG
GGTTAGGTGCCTCTCACCAAACAGGGTGGTGAGTGACCCGTCGTGGGGGATTAGCAGCTGCGTGTGTTAACTTAT
CGCTAGGTCGGGCCTAGTAGCATATCATATTCTTCAAAGCGGAGTGACCTGTCGATTGCCGAGGACACCCAAAAG
TAGGCTCTTCCCCCCATCTCATGCTCAGATTGTGTTCTGATTGAGTTTGAAAACAGCTCCTCGCAGCGTTGTCCA
TCATTACTTTGACGTATGCCTCTTGCCCAACTCTCAACATCAACTTGACCTCTTACATGTTTCTAATAGGAAACT
ATTGATCCCCAGTCCGCAGTTGATCATGATGAGCCACCTAAGTCGGCTTATAGCATGTTTAGCTCCAGCGAAATC
CGCACTCTTTATGACATCTCGCCTGACGCACTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail