Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|040360
Gene name
Locationscaffold_02:404434..408067
Strand+
Gene length (bp)3633
Transcript length (bp)2685
Coding sequence length (bp)2685
Protein length (aa) 895

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 3.0E-44 160 561
PF06280 fn3_5 Fn3-like domain 9.6E-10 605 709

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 41 645 1.0E-44
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 160 593 6.0E-21
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 160 593 3.0E-20
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 160 593 8.0E-20
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 160 593 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 41 645 1.0E-44
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 160 593 6.0E-21
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 160 593 3.0E-20
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 160 593 8.0E-20
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 160 593 4.0E-19
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 162 340 5.0E-18
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 152 315 4.0E-17
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 2 319 4.0E-16
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 2 319 5.0E-16
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 153 319 2.0E-15
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 2 314 3.0E-15
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 137 315 4.0E-15
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 26 337 7.0E-15
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 76 314 1.0E-14
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 151 339 3.0E-14
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 160 287 2.0E-13
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 77 287 2.0E-13
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 163 315 2.0E-12
sp|P0DD35|C5AP_STRPQ C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=scpA PE=3 SV=1 114 541 3.0E-12
sp|P0DD34|C5AP_STRP3 C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=scpA PE=3 SV=1 114 541 3.0E-12
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 159 337 6.0E-12
sp|P58099|C5AP_STRP1 C5a peptidase OS=Streptococcus pyogenes serotype M1 GN=scpA PE=3 SV=1 219 541 9.0E-11
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 157 315 1.0E-10
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 156 353 1.0E-10
sp|Q5X9R0|C5AP_STRP6 C5a peptidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=scpA PE=3 SV=1 94 541 2.0E-10
sp|Q8NZ80|C5AP_STRP8 C5a peptidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=scpA PE=3 SV=1 135 541 3.0E-10
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 131 295 3.0E-10
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 156 340 5.0E-10
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 154 338 5.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 151 314 6.0E-10
sp|P15926|C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes GN=scpA PE=1 SV=1 219 541 8.0E-10
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 153 354 2.0E-09
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 152 350 2.0E-09
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 152 350 3.0E-09
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 36 338 5.0E-09
sp|Q0WUG6|SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana GN=SBT6.1 PE=1 SV=1 149 339 1.0E-08
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 156 353 1.0E-08
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 154 338 2.0E-08
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 165 338 4.0E-08
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 134 338 6.0E-08
sp|Q9LNU1|CRSP_ARATH CO(2)-response secreted protease OS=Arabidopsis thaliana GN=CRSP PE=2 SV=1 208 539 6.0E-08
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 134 338 7.0E-08
sp|P72186|PLS_PYRFU Pyrolysin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pls PE=1 SV=2 466 587 7.0E-08
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 96 338 1.0E-07
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 155 350 1.0E-07
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 154 338 1.0E-07
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 150 340 1.0E-07
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 157 382 2.0E-07
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 156 267 2.0E-07
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 157 341 2.0E-07
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 156 267 2.0E-07
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 113 341 3.0E-07
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 150 340 4.0E-07
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 113 341 4.0E-07
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 157 340 4.0E-07
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 141 339 5.0E-07
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 64 328 5.0E-07
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 156 328 5.0E-07
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 150 267 8.0E-07
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 155 340 8.0E-07
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 113 341 9.0E-07
sp|O64495|SBT12_ARATH Subtilisin-like protease SBT1.2 OS=Arabidopsis thaliana GN=SBT1.2 PE=2 SV=1 129 542 1.0E-06
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 62 262 1.0E-06
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 137 352 1.0E-06
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 53 252 2.0E-06
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 160 316 2.0E-06
sp|Q9FIG1|SBT4B_ARATH Subtilisin-like protease SBT4.11 OS=Arabidopsis thaliana GN=SBT4.11 PE=2 SV=2 165 539 2.0E-06
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 162 313 3.0E-06
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 156 328 3.0E-06
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 150 341 3.0E-06
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 151 338 4.0E-06
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 160 316 7.0E-06
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 156 328 7.0E-06
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 160 337 7.0E-06
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 160 337 7.0E-06
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 144 338 7.0E-06
sp|O49607|SBT16_ARATH Subtilisin-like protease SBT1.6 OS=Arabidopsis thaliana GN=SBT1.6 PE=2 SV=1 218 542 7.0E-06
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 156 328 8.0E-06
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 14 337 8.0E-06
sp|Q9FHA4|SBT19_ARATH Subtilisin-like protease SBT1.9 OS=Arabidopsis thaliana GN=SBT1.9 PE=2 SV=1 160 543 8.0E-06
sp|P51559|BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans GN=bli-4 PE=2 SV=2 156 371 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0005618 cell wall Yes
GO:0016020 membrane Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008233 peptidase activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0030312 external encapsulating structure No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0004175 endopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|040360
MMKARTLLIFLLDIHLVLAAIKSISSVQHKSNLPTASNRFIVEVEDTSQIPPSERSTLSPHELLFEHLKARNVTF
NVTKQYKAEGLFVGASITLDNPQDVSALKSAPGVKDVRPVRQFSIPKPVSKYTVTCRNDPAIPPDTEGTHVATGV
DKLHAEGITGKGIKIGIIDSGVDYTHPSLGGGFGPGFKIVGGYDFVGDDYDGTNTPAPDDDPMDKCSGHGTHVAG
IIAADPGNEFNISGVAYEASLSMYRVFGCSGSVADDVLVDALLMAFIDEQDILTLSIGGTDGWTESISAVLTSRF
VEQGKVVTIAAGNDGIWGSWYTSSPGNGIDVISVASTDNYVIPLQNATVGGVKHDPITYLDTLPLPVNGTFPIYA
TSNSTTVEDDACNPLPDSTPDLSDMVVIIRNGSCTAVQKLTNAAAKGAQVALIYDELFTSMDLGSFTASIIQEAD
GEWLIQQFVAGTPVTLTFPQHGGSADFPNPFGGLISIFTSYGPSNDFYFKPAIATPGGNILSTLPDGTFGVASGT
SMATPFAAGSAALILQARGKDIELARGVRSLLESTGQKVPSTKIEGDPLQTVTQQGAGLVNVYDAVHAETIVMPT
ELIVNDTAHAEPKQSFSVLNAGKSSKEYILSHVPAGTALTVQADSIAPAPGPVPLSNSTATVSISPSKFTLGPGD
SQNVTAEIFGPTGLDRTTFPVYSGFIDIDDGSQSFHVVYLGLTGSLIDKQVIDDTDSFFGVNVPTIIDSEGNVQE
GAMNYTFEGGDIPTLIWRQVFGSPRVVVDLVDRDIQINTTLNSRDVDNGARPFISFPTSTAPGSFAQVETIGSIL
EYNFVSRNSDNPNVNGYYSFAWETPTYANGTVVENGVYRLLLRALRVTGDVAKEEDYEVYLSSIVGVDV*
Coding >Agabi119p4|040360
ATGATGAAGGCTCGAACGTTGCTAATATTTTTGCTGGACATACATTTGGTGTTGGCCGCGATCAAATCCATTTCC
AGTGTCCAACACAAATCCAATCTCCCTACCGCAAGCAACAGATTTATTGTTGAAGTTGAGGATACATCCCAGATT
CCTCCCTCAGAGCGTTCTACTTTATCACCACACGAGCTTCTGTTTGAACATCTCAAAGCTCGGAATGTGACTTTC
AATGTTACGAAACAATATAAGGCTGAAGGCCTTTTTGTTGGGGCTTCAATCACGTTGGACAATCCTCAAGATGTT
TCTGCGTTAAAATCTGCACCAGGAGTGAAAGATGTCCGGCCCGTGCGGCAATTCAGCATCCCAAAGCCTGTATCC
AAATATACCGTTACCTGTCGGAACGATCCTGCCATCCCACCTGACACTGAAGGTACTCACGTTGCCACGGGTGTT
GATAAACTTCATGCCGAGGGGATTACTGGTAAAGGAATCAAAATCGGCATTATTGACTCCGGTGTCGATTATACT
CATCCATCTCTTGGAGGTGGTTTTGGACCAGGGTTTAAAATCGTTGGTGGATATGATTTCGTCGGGGATGACTAC
GATGGTACGAATACTCCTGCACCTGACGATGATCCTATGGACAAATGTAGTGGACACGGCACACATGTAGCAGGC
ATCATTGCTGCTGACCCAGGGAATGAATTTAATATCAGCGGTGTGGCATACGAAGCGTCGCTTTCTATGTATAGG
GTCTTTGGATGTTCTGGATCTGTCGCTGACGATGTTCTTGTGGATGCACTGTTAATGGCATTCATCGACGAACAA
GATATATTGACGTTATCAATTGGTGGGACCGATGGTTGGACCGAATCCATTTCAGCAGTTTTGACAAGTCGATTT
GTTGAGCAAGGAAAGGTTGTGACTATTGCTGCTGGAAACGATGGTATCTGGGGATCTTGGTATACGTCTAGCCCT
GGGAACGGTATCGACGTTATCTCTGTTGCTAGTACCGACAACTATGTTATTCCTCTTCAAAACGCAACCGTCGGT
GGAGTCAAACACGACCCGATAACTTATTTGGATACCCTCCCACTTCCTGTCAACGGTACCTTTCCTATATACGCT
ACTTCGAATTCAACTACAGTCGAAGACGACGCATGTAACCCACTCCCGGATTCGACACCGGATTTATCTGATATG
GTTGTGATCATTCGGAATGGATCATGTACTGCTGTTCAAAAATTGACAAATGCAGCTGCGAAAGGAGCTCAAGTT
GCTTTGATTTATGACGAGTTGTTCACGTCGATGGATCTGGGATCTTTTACTGCTTCGATTATTCAAGAAGCCGAC
GGTGAATGGCTTATACAGCAATTTGTTGCTGGTACTCCTGTCACATTAACCTTTCCGCAACATGGAGGATCGGCC
GATTTTCCTAACCCATTCGGCGGCCTCATATCCATCTTCACCAGTTACGGACCCAGTAATGATTTCTACTTCAAA
CCCGCTATAGCGACGCCAGGTGGAAACATTCTTTCCACATTACCTGATGGTACATTTGGTGTTGCATCTGGAACA
TCCATGGCTACACCATTCGCTGCTGGCAGTGCTGCTCTGATTCTTCAAGCTCGAGGCAAAGATATTGAACTTGCA
AGAGGCGTTCGTTCGTTATTGGAATCTACTGGACAGAAAGTGCCTTCTACTAAAATTGAGGGTGATCCATTACAA
ACGGTGACGCAACAAGGAGCTGGGTTAGTTAATGTTTATGATGCTGTGCATGCGGAGACGATTGTTATGCCGACG
GAGTTGATTGTGAATGATACTGCGCATGCTGAACCAAAGCAGAGCTTTAGTGTTTTGAATGCAGGAAAATCGTCA
AAGGAGTATATTCTTAGTCATGTTCCAGCTGGTACGGCTTTAACTGTCCAAGCTGACTCTATCGCCCCAGCGCCT
GGTCCAGTTCCTCTATCAAATTCCACAGCGACTGTATCTATCAGTCCCTCGAAATTCACTTTGGGACCTGGTGAT
TCGCAAAACGTGACTGCCGAGATTTTTGGACCTACTGGACTGGATAGGACAACCTTTCCGGTGTATTCTGGGTTT
ATTGATATTGATGATGGGAGTCAAAGTTTTCATGTTGTGTATCTTGGGTTGACTGGGTCGTTGATTGATAAACAA
GTGATTGATGATACTGATTCTTTTTTTGGTGTGAATGTTCCTACTATTATTGATAGTGAAGGGAATGTTCAGGAG
GGAGCTATGAATTATACATTTGAGGGTGGAGACATTCCGACATTAATTTGGCGACAAGTGTTTGGATCCCCGCGT
GTGGTAGTTGACCTTGTGGATCGGGATATTCAAATCAATACGACATTGAATAGTAGGGATGTCGACAACGGAGCA
AGACCATTTATTTCTTTCCCCACATCAACAGCACCGGGAAGTTTTGCTCAAGTGGAGACAATAGGATCTATATTA
GAGTATAATTTCGTTTCGCGGAACTCTGACAATCCTAATGTGAATGGGTATTATTCATTCGCCTGGGAGACGCCG
ACGTACGCGAATGGGACAGTGGTAGAGAATGGAGTGTATAGACTGCTCTTGCGAGCACTACGAGTTACGGGAGAT
GTGGCGAAAGAAGAGGATTACGAGGTTTACCTGAGCTCCATTGTTGGGGTTGATGTTTAA
Transcript >Agabi119p4|040360
ATGATGAAGGCTCGAACGTTGCTAATATTTTTGCTGGACATACATTTGGTGTTGGCCGCGATCAAATCCATTTCC
AGTGTCCAACACAAATCCAATCTCCCTACCGCAAGCAACAGATTTATTGTTGAAGTTGAGGATACATCCCAGATT
CCTCCCTCAGAGCGTTCTACTTTATCACCACACGAGCTTCTGTTTGAACATCTCAAAGCTCGGAATGTGACTTTC
AATGTTACGAAACAATATAAGGCTGAAGGCCTTTTTGTTGGGGCTTCAATCACGTTGGACAATCCTCAAGATGTT
TCTGCGTTAAAATCTGCACCAGGAGTGAAAGATGTCCGGCCCGTGCGGCAATTCAGCATCCCAAAGCCTGTATCC
AAATATACCGTTACCTGTCGGAACGATCCTGCCATCCCACCTGACACTGAAGGTACTCACGTTGCCACGGGTGTT
GATAAACTTCATGCCGAGGGGATTACTGGTAAAGGAATCAAAATCGGCATTATTGACTCCGGTGTCGATTATACT
CATCCATCTCTTGGAGGTGGTTTTGGACCAGGGTTTAAAATCGTTGGTGGATATGATTTCGTCGGGGATGACTAC
GATGGTACGAATACTCCTGCACCTGACGATGATCCTATGGACAAATGTAGTGGACACGGCACACATGTAGCAGGC
ATCATTGCTGCTGACCCAGGGAATGAATTTAATATCAGCGGTGTGGCATACGAAGCGTCGCTTTCTATGTATAGG
GTCTTTGGATGTTCTGGATCTGTCGCTGACGATGTTCTTGTGGATGCACTGTTAATGGCATTCATCGACGAACAA
GATATATTGACGTTATCAATTGGTGGGACCGATGGTTGGACCGAATCCATTTCAGCAGTTTTGACAAGTCGATTT
GTTGAGCAAGGAAAGGTTGTGACTATTGCTGCTGGAAACGATGGTATCTGGGGATCTTGGTATACGTCTAGCCCT
GGGAACGGTATCGACGTTATCTCTGTTGCTAGTACCGACAACTATGTTATTCCTCTTCAAAACGCAACCGTCGGT
GGAGTCAAACACGACCCGATAACTTATTTGGATACCCTCCCACTTCCTGTCAACGGTACCTTTCCTATATACGCT
ACTTCGAATTCAACTACAGTCGAAGACGACGCATGTAACCCACTCCCGGATTCGACACCGGATTTATCTGATATG
GTTGTGATCATTCGGAATGGATCATGTACTGCTGTTCAAAAATTGACAAATGCAGCTGCGAAAGGAGCTCAAGTT
GCTTTGATTTATGACGAGTTGTTCACGTCGATGGATCTGGGATCTTTTACTGCTTCGATTATTCAAGAAGCCGAC
GGTGAATGGCTTATACAGCAATTTGTTGCTGGTACTCCTGTCACATTAACCTTTCCGCAACATGGAGGATCGGCC
GATTTTCCTAACCCATTCGGCGGCCTCATATCCATCTTCACCAGTTACGGACCCAGTAATGATTTCTACTTCAAA
CCCGCTATAGCGACGCCAGGTGGAAACATTCTTTCCACATTACCTGATGGTACATTTGGTGTTGCATCTGGAACA
TCCATGGCTACACCATTCGCTGCTGGCAGTGCTGCTCTGATTCTTCAAGCTCGAGGCAAAGATATTGAACTTGCA
AGAGGCGTTCGTTCGTTATTGGAATCTACTGGACAGAAAGTGCCTTCTACTAAAATTGAGGGTGATCCATTACAA
ACGGTGACGCAACAAGGAGCTGGGTTAGTTAATGTTTATGATGCTGTGCATGCGGAGACGATTGTTATGCCGACG
GAGTTGATTGTGAATGATACTGCGCATGCTGAACCAAAGCAGAGCTTTAGTGTTTTGAATGCAGGAAAATCGTCA
AAGGAGTATATTCTTAGTCATGTTCCAGCTGGTACGGCTTTAACTGTCCAAGCTGACTCTATCGCCCCAGCGCCT
GGTCCAGTTCCTCTATCAAATTCCACAGCGACTGTATCTATCAGTCCCTCGAAATTCACTTTGGGACCTGGTGAT
TCGCAAAACGTGACTGCCGAGATTTTTGGACCTACTGGACTGGATAGGACAACCTTTCCGGTGTATTCTGGGTTT
ATTGATATTGATGATGGGAGTCAAAGTTTTCATGTTGTGTATCTTGGGTTGACTGGGTCGTTGATTGATAAACAA
GTGATTGATGATACTGATTCTTTTTTTGGTGTGAATGTTCCTACTATTATTGATAGTGAAGGGAATGTTCAGGAG
GGAGCTATGAATTATACATTTGAGGGTGGAGACATTCCGACATTAATTTGGCGACAAGTGTTTGGATCCCCGCGT
GTGGTAGTTGACCTTGTGGATCGGGATATTCAAATCAATACGACATTGAATAGTAGGGATGTCGACAACGGAGCA
AGACCATTTATTTCTTTCCCCACATCAACAGCACCGGGAAGTTTTGCTCAAGTGGAGACAATAGGATCTATATTA
GAGTATAATTTCGTTTCGCGGAACTCTGACAATCCTAATGTGAATGGGTATTATTCATTCGCCTGGGAGACGCCG
ACGTACGCGAATGGGACAGTGGTAGAGAATGGAGTGTATAGACTGCTCTTGCGAGCACTACGAGTTACGGGAGAT
GTGGCGAAAGAAGAGGATTACGAGGTTTACCTGAGCTCCATTGTTGGGGTTGATGTTTAA
Gene >Agabi119p4|040360
ATGATGAAGGCTCGAACGTTGCTAATATTTTTGCTGGACATACATTTGGTGTTGGCCGCGATCAAATCCATTTCC
AGTGTCCAACACAAATCCAATCTCCCTACCGCAAGCAACAGATTTATTGTTGAAGTTGAGGATACATCCCAGATT
CCTCCCTCAGAGCGTTCTACTTTATCAGTATGTGCCCTGGTTCTGGATCTTTGAAACTTGTACTCATGGATTGAT
TTGTAAAGCCACACGAGCTTCTGTTTGAACATCTCAAAGCTCGGAATGTGACTTTCAATGTTACGAAACAATATA
AGGCTGAAGGCCTTTTTGTTGGGGCTTCAATCACGTTGGACAATCCTCAAGTAAGCGATCGTATGCTCTTGTCTA
CCATCGAAGCTAAAAGAATTGAACCAAGGATGTTTCTGCGTTAAAATCTGCACCAGGAGTGAAAGATGTCCGGCC
CGTGCGGCAATTCAGCATCCCAAAGTATGTTCTCATCCTCGTATAAATATATAGGAACGGAGGCTTTTGCTAGGC
CTGTATCCAAATATACCGTTACCTGTCGGAACGATCCTGCCATCCCACCTGACACTGAAGGTACTCACGTTGCCA
CGGTGAGAGCCTCCACTTGTTTATATCTAGTCTTCCTCTTAAATTTTCTTACAGGGTGTTGATAAACTTCATGCC
GAGGGGATTACTGGTAAAGGAATCAAAATCGGCATGTAAGCAACCCATTTGATCCTTTATTTTGCGCCTTTCTCT
CATCTCTCTTTTTTTTAGTATTGACTCCGGTATGAATGATTTATGATCTTCAAGAAATCTAGAAAGGAATTGAAT
GTTCTAGGTGTCGATTATACTCATCCATCTCTTGGAGGTGGTTTTGGACCAGGGTTTAAAATCGTTGGTGGATAT
GATTTCGTCGGGGATGACTACGATGGTCGATATAGACTCCCATAAATTTCATAAACCCAAATCTCACACGTGCCC
GACTTCACAGGTACGAATACTCCTGCACCTGACGATGATCCTATGGACAAATGTAGTGGACACGGCACACATGTA
GCAGTGAGTCTCCCTCTTGAAAATCCACTACTTTGATTTTTACATCTTACAGGGCATCATTGCTGCTGACCCAGG
GAATGAATTTAATATCAGCGGTGTGGCATACGAAGCGTCGCTTTCTATGTATAGGGTCTTTGGATGTTCTGGATC
TGTCGCTGACGATGGTACGTTGTGTACCTTTCTTTCCAAAGTAGCAGACACAAACAATTTTCAACTCGCGTGATT
TTCTAGTTCTTGTGGATGCACTGTTAATGGCATTCATCGACGAACAAGATATATTGACGTTATCAATTGGTGGGA
CCGATGGTTGGACCGAATCCATTTCAGCAGTTTTGACAAGTCGATTTGTTGAGCAAGGAAAGGTTGTGACTATTG
CTGCTGGAAACGATGTGAGTTTCTTTTTGATCCCCCGCCCACTCTATACCCCGGTTATTGACTGAGGGTTTAGGG
TATCTGGGGATCTTGGTATACGTCTAGCCCTGGGAACGGTATCGACGTTATCTCTGTTGCTAGTACCGACAAGTA
AGAGCTTCAATGTCTCTTTTAGTCATACTATGAAACTGACGACAAATATTAAAGCTATGTTATTCCTCTTCAAAA
CGCAACCGTCGGTGGAGTCAAACACGACCCGATAACTTATTTGGATACCCTCCCACTTCCTGTCAACGGTACCTT
TCCTATATACGCTACTTCGAATTCAACTACAGTCGAAGACGACGCATGTAACCCACTCCCGGATTCGACACCGGA
TTTATCTGATATGGTTGTGATCATTCGGAATGGATCATGTACTGCTGTTCAAAAATTGACAAATGCAGCTGCGAA
AGGAGCTCAAGTTGCTTTGATTTATGAGTGAGTTTTGTGTTTTGGAATAGGTGATCTTGGATGTCGTTGATGCAT
GTGATTTTTGTAGCGAGTTGTTCACGTCGATGGATCTGGGATCTTTTACTGCTTCGATTATTCAAGAAGCCGACG
GTGAATGGGTGAGCTTGATTGTCCTAATTCATGTTCTTCTATCTTACGATTTTTCTCGCAGCTTATACAGCAATT
TGTTGCTGGTACTCCTGTCACATTAACCTTTCCGCAACATGGAGGATCGGCCGATTTTCCTAACCCATTCGGCGG
CCTCATATCCATCTTCACCAGGTACCCACTAAGTAATCCTAAGAAGCCCGCTTTTAACAGCAGTACAGTTACGGA
CCCAGTAATGATTTCTACTTCAAACCCGCTATAGCGACGCCAGGTGGAAACATTCTTTCCACATTACCTGATGGT
ACATTTGGTGTTGCATCTGGAACATCCATGGCTACACCATTCGCTGCTGGCAGTGCTGCTCTGATTCTTCAAGCT
CGAGGCAAAGATATTGAACTTGCAAGAGGCGTTCGTTCGTTATTGGAATCTACTGGACAGAAAGTGCCTTCTACT
AAAATTGAGGGTGATCCATTACAAACGGTGACGCAACAAGGAGCTGGGTTAGTTAATGTTTATGATGCTGTGCAT
GCGGAGACGATTGTTATGCCGACGGAGTTGATTGTGAATGATACTGCGCATGCTGAACCAAAGTAAGTTTATGTG
TGACACGATTTTTTTGGGGGAATTTTTTGATTATTATTTGTTTAGGCAGAGCTTTAGTGTTTTGAATGCAGGAAA
ATCGTCAAAGGAGTATATTCTTAGTCATGTTCCAGCTGGTACGGCTTTAACTGTCCAAGCTGACTCTATCGCCCC
AGCGCCTGGTCCAGTTCCTCTATCAAATTCCACAGCGACTGTATCTATCAGTCCCTCGAAATTCACTTTGGGACC
TGGTGATTCGCAAAACGTGACTGCCGAGATTTTTGGACCTACTGGACTGGATAGGACAACCTTTCCGGTGTATTC
TGGGTTTATTGATATTGATGATGGGAGTCAAAGTTTTCATGTTGTGTATCTTGGGTTGACTGGGTCGTTGATTGA
TAAACAAGTGATTGATGATACTGATTCTTTTTTTGGTGTGAATGTTCCTACTATTATTGATAGTGAAGGGAATGT
TCAGGAGGGAGCTATGAATTATACATTTGAGGGTGGAGACATTCCGACATTAATTTGGCGGTGAGTTGATTGTTA
ACTTGTAAAAGACATGAATGCTAAAAACTTATTTATAGACAAGTGTTTGGATCCCCGCGTGTGGTAGTTGACCTT
GTGGATCGGGATATTCAAATCAATACGACATTGAATAGTAGGGATGTCGACAACGGAGCAAGACCATTTATTTCT
TTCCCCACATCAACAGCACCGGGAAGTTTTGCTCAAGTGGAGACAATAGGATCTATATTAGAGTATAATTTCGTT
TCGCGGAACTCTGACGTGAGTGAATATGAAGTTAGCGTAAGAGAGATTTTTTGAAAGCTAATAATCTGATTTGGA
AAGAATCCTAATGTGAATGGGTATTATTCATTCGCCTGGGAGACGCCGACGTACGCGAATGGGACAGTGGTAGAG
AATGGAGTGTATAGACTGCTCTTGCGAGCACTACGAGTTACGGGAGATGTGGCGAAAGAAGAGGATTACGAGGTT
TACCTGAGCTCCATTGTTGGGGTTGATGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail