Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|038940
Gene name
Locationscaffold_02:106074..111876
Strand-
Gene length (bp)5802
Transcript length (bp)5631
Coding sequence length (bp)5631
Protein length (aa) 1877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 8.0E-38 1306 1454
PF13855 LRR_8 Leucine rich repeat 2.2E-06 709 766
PF13855 LRR_8 Leucine rich repeat 3.4E-09 999 1059
PF13855 LRR_8 Leucine rich repeat 4.1E-07 1023 1080
PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain 9.7E-20 1509 1670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 444 1839 0.0E+00
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 280 1729 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 514 1732 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 368 1838 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 439 1766 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 444 1839 0.0E+00
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 280 1729 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 514 1732 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 368 1838 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 439 1766 0.0E+00
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 439 1729 3.0E-154
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 684 1461 3.0E-35
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 546 933 2.0E-30
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 529 933 5.0E-30
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 578 933 6.0E-28
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 529 933 6.0E-28
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 566 933 9.0E-28
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 578 933 1.0E-27
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 578 933 1.0E-27
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 578 933 1.0E-27
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 620 1082 1.0E-27
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 620 1082 1.0E-27
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 620 1082 4.0E-27
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 580 934 1.0E-26
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 604 933 1.0E-26
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 664 933 4.0E-26
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 529 933 5.0E-26
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 569 933 5.0E-26
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 578 933 9.0E-26
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 529 933 9.0E-26
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 529 933 9.0E-26
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 529 933 1.0E-25
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 618 1079 3.0E-25
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 1510 1705 3.0E-25
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 664 1080 1.0E-24
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 685 1082 2.0E-24
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 541 1080 2.0E-24
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 625 1083 2.0E-24
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 647 933 3.0E-24
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 569 933 6.0E-24
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 685 1120 1.0E-23
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 534 933 2.0E-23
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 556 1080 2.0E-23
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 529 933 2.0E-23
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 685 1080 2.0E-23
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 647 933 2.0E-23
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 635 933 3.0E-23
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 1510 1669 3.0E-23
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 685 1080 6.0E-23
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 685 1083 7.0E-23
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 625 1083 7.0E-23
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 570 1084 7.0E-23
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 685 1080 7.0E-23
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 685 1080 8.0E-23
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 532 1016 1.0E-22
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 1204 1509 1.0E-22
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 625 1083 1.0E-22
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 685 1080 1.0E-22
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 618 1109 2.0E-22
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 685 1080 2.0E-22
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 690 1080 2.0E-22
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 557 940 3.0E-22
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 548 927 3.0E-22
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 685 1080 3.0E-22
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 685 1080 4.0E-22
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 697 1084 6.0E-22
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 685 1082 1.0E-21
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 685 1082 2.0E-21
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 685 1082 2.0E-21
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 625 1083 2.0E-21
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 568 933 2.0E-21
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 685 1082 3.0E-21
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 532 1016 3.0E-21
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 675 1080 3.0E-21
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 618 1109 4.0E-21
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 685 1080 4.0E-21
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 635 933 6.0E-21
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 613 1080 9.0E-21
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 570 927 1.0E-20
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 570 927 1.0E-20
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 570 927 1.0E-20
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 532 933 1.0E-20
sp|P26338|CYAA_TRYEQ Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma equiperdum GN=ESAG4C PE=3 SV=1 1514 1700 1.0E-20
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 625 1083 2.0E-20
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 532 933 2.0E-20
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 647 1080 2.0E-20
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 564 913 2.0E-20
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 542 1080 3.0E-20
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 542 1080 3.0E-20
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 685 1102 4.0E-20
sp|Q26896|CYAA_TRYCO Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma congolense PE=2 SV=1 1514 1663 4.0E-20
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 826 1083 5.0E-20
sp|Q99280|CY43_TRYBB Receptor-type adenylate cyclase GRESAG 4.3 OS=Trypanosoma brucei brucei GN=GRESAG 4.3 PE=1 SV=1 1510 1685 6.0E-20
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 566 913 8.0E-20
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 713 1080 1.0E-19
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 711 1091 1.0E-19
sp|Q27675|CYAA_LEIDO Receptor-type adenylate cyclase A OS=Leishmania donovani GN=RAC-A PE=2 SV=1 1514 1662 1.0E-19
sp|Q25263|CYAB_LEIDO Receptor-type adenylate cyclase B OS=Leishmania donovani GN=RAC-B PE=2 SV=1 1514 1662 1.0E-19
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 549 948 2.0E-19
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 615 1082 2.0E-19
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 1504 1669 2.0E-19
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 723 1080 2.0E-19
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 1147 1461 3.0E-19
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 555 1037 4.0E-19
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 624 1083 4.0E-19
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 624 1083 4.0E-19
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 539 1080 4.0E-19
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 537 934 5.0E-19
sp|Q26721|CYA4_TRYBB Receptor-type adenylate cyclase ESAG 4 OS=Trypanosoma brucei brucei GN=ESAG4 PE=3 SV=1 1514 1682 6.0E-19
sp|Q99396|CY42_TRYBB Receptor-type adenylate cyclase GRESAG 4.2 (Fragment) OS=Trypanosoma brucei brucei GN=GRESAG 4.2 PE=2 SV=1 1514 1709 8.0E-19
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 618 1077 1.0E-18
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 713 1090 1.0E-18
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 660 1080 1.0E-18
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 624 1080 2.0E-18
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 685 1084 2.0E-18
sp|Q99279|CY41_TRYBB Receptor-type adenylate cyclase GRESAG 4.1 OS=Trypanosoma brucei brucei GN=GRESAG 4.1 PE=1 SV=1 1501 1683 2.0E-18
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 1302 1502 2.0E-18
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 677 910 3.0E-18
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 594 913 3.0E-18
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 618 809 4.0E-18
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 570 831 4.0E-18
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 566 913 5.0E-18
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 618 1080 6.0E-18
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 541 893 6.0E-18
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 618 809 9.0E-18
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 537 927 1.0E-17
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 618 1080 1.0E-17
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 618 1080 1.0E-17
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 618 1080 2.0E-17
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 618 1080 2.0E-17
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 618 934 2.0E-17
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 1309 1462 2.0E-17
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 732 1083 3.0E-17
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 774 1082 3.0E-17
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 557 1122 4.0E-17
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 620 1080 4.0E-17
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 1309 1462 5.0E-17
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 1309 1477 5.0E-17
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 564 933 6.0E-17
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 609 933 6.0E-17
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 669 933 6.0E-17
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 593 1095 6.0E-17
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 1309 1467 6.0E-17
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 557 900 8.0E-17
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 624 1080 9.0E-17
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 1309 1462 9.0E-17
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 541 1080 9.0E-17
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 541 933 1.0E-16
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 541 933 1.0E-16
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 541 933 1.0E-16
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 628 1083 1.0E-16
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 618 964 1.0E-16
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 568 809 1.0E-16
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 631 933 1.0E-16
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 680 1082 2.0E-16
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 732 1080 2.0E-16
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 732 1119 2.0E-16
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 618 1077 2.0E-16
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 541 933 2.0E-16
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 541 933 2.0E-16
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 868 1080 2.0E-16
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 542 787 2.0E-16
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 1303 1461 2.0E-16
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 813 1082 3.0E-16
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 570 1057 3.0E-16
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 570 899 4.0E-16
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 1302 1461 4.0E-16
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 813 1082 6.0E-16
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 549 948 7.0E-16
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 829 1084 8.0E-16
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 732 1095 1.0E-15
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 1308 1461 1.0E-15
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 544 939 2.0E-15
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 1322 1461 2.0E-15
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 541 933 2.0E-15
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 541 927 2.0E-15
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 813 1080 2.0E-15
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 839 1082 2.0E-15
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 553 927 2.0E-15
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 621 1080 2.0E-15
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 567 831 2.0E-15
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 557 1086 2.0E-15
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 569 759 3.0E-15
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 564 937 3.0E-15
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 1300 1468 3.0E-15
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 570 937 3.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 860 1104 4.0E-15
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 556 788 4.0E-15
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 1307 1461 4.0E-15
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 699 1080 4.0E-15
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 628 890 4.0E-15
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 830 1090 4.0E-15
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 570 1014 4.0E-15
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 690 1110 5.0E-15
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 690 1110 5.0E-15
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 813 1080 5.0E-15
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 1204 1461 5.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 794 1067 6.0E-15
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 1275 1462 6.0E-15
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 1307 1463 6.0E-15
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 557 797 7.0E-15
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 690 1110 8.0E-15
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 1308 1462 8.0E-15
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 1322 1461 9.0E-15
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 639 1080 9.0E-15
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 1307 1463 9.0E-15
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 1307 1463 9.0E-15
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 544 939 1.0E-14
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 557 948 1.0E-14
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 617 891 1.0E-14
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 844 1092 1.0E-14
sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 567 1084 1.0E-14
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 1322 1461 2.0E-14
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 557 816 2.0E-14
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 732 1084 2.0E-14
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 844 1067 2.0E-14
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 684 1110 2.0E-14
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 612 954 2.0E-14
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 557 881 2.0E-14
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 558 940 2.0E-14
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 690 1110 3.0E-14
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 609 933 3.0E-14
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 844 1083 3.0E-14
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 723 927 3.0E-14
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 557 851 4.0E-14
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 557 1153 4.0E-14
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 595 1059 4.0E-14
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 609 812 4.0E-14
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 553 927 4.0E-14
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 569 933 5.0E-14
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 677 1086 5.0E-14
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 1308 1463 5.0E-14
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 774 1090 6.0E-14
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 850 1083 6.0E-14
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 628 892 6.0E-14
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 544 939 7.0E-14
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 612 906 7.0E-14
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 844 1082 8.0E-14
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 638 1080 8.0E-14
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 1308 1470 9.0E-14
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 544 939 1.0E-13
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 667 891 1.0E-13
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 604 800 1.0E-13
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 556 959 1.0E-13
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 617 1089 1.0E-13
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 570 757 1.0E-13
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 570 1014 1.0E-13
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 825 1122 1.0E-13
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 1302 1467 1.0E-13
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 663 873 1.0E-13
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 1308 1462 1.0E-13
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 1271 1459 1.0E-13
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 826 1083 2.0E-13
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 557 935 2.0E-13
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 613 913 2.0E-13
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 640 1112 2.0E-13
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 564 933 2.0E-13
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 556 904 2.0E-13
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 709 933 2.0E-13
sp|Q6P3Y9|PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus GN=Podnl1 PE=2 SV=2 621 1110 2.0E-13
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 723 927 2.0E-13
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 1301 1464 2.0E-13
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 604 800 2.0E-13
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 556 769 3.0E-13
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 1307 1513 3.0E-13
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 839 1082 3.0E-13
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 677 915 3.0E-13
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 566 757 3.0E-13
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 570 919 3.0E-13
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 664 1112 3.0E-13
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 657 938 4.0E-13
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 557 927 5.0E-13
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 544 939 5.0E-13
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 723 927 5.0E-13
sp|Q6ETK3|P2C11_ORYSJ Probable protein phosphatase 2C 11 OS=Oryza sativa subsp. japonica GN=Os02g0180000 PE=2 SV=1 1308 1427 5.0E-13
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 1225 1461 6.0E-13
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 604 800 6.0E-13
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 536 750 7.0E-13
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 513 1079 7.0E-13
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 695 938 8.0E-13
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 620 810 9.0E-13
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 1204 1461 1.0E-12
sp|Q69VD9|P2C57_ORYSJ Probable protein phosphatase 2C 57 OS=Oryza sativa subsp. japonica GN=Os06g0597200 PE=2 SV=1 1298 1459 1.0E-12
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 681 1080 1.0E-12
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 612 1080 1.0E-12
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 1314 1462 1.0E-12
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 757 1132 1.0E-12
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 544 759 2.0E-12
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 693 1083 2.0E-12
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 713 1074 2.0E-12
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 674 910 2.0E-12
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 1309 1462 2.0E-12
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 618 810 2.0E-12
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 620 810 2.0E-12
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 813 1082 3.0E-12
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 556 829 3.0E-12
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 567 935 3.0E-12
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 1308 1462 3.0E-12
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 603 1082 3.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 553 807 3.0E-12
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 844 1083 4.0E-12
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 661 1082 4.0E-12
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 713 1074 4.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 664 904 4.0E-12
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 658 1064 4.0E-12
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 671 1109 4.0E-12
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 557 927 5.0E-12
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 573 769 5.0E-12
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 844 1084 5.0E-12
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 557 933 5.0E-12
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 1310 1464 5.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 569 759 5.0E-12
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 1289 1467 5.0E-12
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 674 892 6.0E-12
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 568 788 6.0E-12
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 674 913 7.0E-12
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 1308 1459 7.0E-12
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 1308 1462 7.0E-12
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 556 829 1.0E-11
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 779 1066 1.0E-11
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 723 1080 1.0E-11
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 544 1087 1.0E-11
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 519 937 1.0E-11
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 565 913 1.0E-11
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 556 735 1.0E-11
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 1303 1462 1.0E-11
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 557 747 1.0E-11
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 569 759 1.0E-11
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 1285 1461 1.0E-11
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 544 753 2.0E-11
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 743 1082 2.0E-11
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 557 927 2.0E-11
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 557 1109 2.0E-11
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 860 1135 2.0E-11
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 1275 1459 2.0E-11
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 1309 1461 2.0E-11
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 556 930 2.0E-11
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 556 735 2.0E-11
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 564 915 2.0E-11
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 556 735 2.0E-11
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 563 759 2.0E-11
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 672 1109 3.0E-11
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 804 1082 3.0E-11
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 713 1059 3.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 620 835 3.0E-11
sp|A0DSB3|PP2C6_PARTE Probable protein phosphatase 2C 6 OS=Paramecium tetraurelia GN=GSPATT00019634001 PE=3 SV=1 1308 1427 3.0E-11
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 569 1086 3.0E-11
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 1301 1440 3.0E-11
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 1308 1513 3.0E-11
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 582 905 4.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 590 768 4.0E-11
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 564 779 4.0E-11
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 567 935 4.0E-11
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 549 1097 4.0E-11
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 693 1063 4.0E-11
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 563 759 4.0E-11
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 730 1057 5.0E-11
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 1308 1427 5.0E-11
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 743 1082 6.0E-11
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 609 936 6.0E-11
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 473 764 6.0E-11
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 612 1082 6.0E-11
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 556 735 7.0E-11
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 1308 1459 7.0E-11
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 713 1080 7.0E-11
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 613 1080 7.0E-11
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 826 1083 8.0E-11
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 713 1074 8.0E-11
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 1176 1462 8.0E-11
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 826 1082 9.0E-11
sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=2 713 1080 9.0E-11
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 869 1162 1.0E-10
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 567 766 1.0E-10
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 669 910 1.0E-10
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 826 1084 1.0E-10
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 798 1084 1.0E-10
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 677 906 1.0E-10
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 713 1083 1.0E-10
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 567 769 1.0E-10
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 604 936 1.0E-10
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 556 735 1.0E-10
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 637 812 1.0E-10
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 591 930 1.0E-10
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 1308 1427 1.0E-10
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 1308 1427 1.0E-10
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 676 913 1.0E-10
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 556 1082 1.0E-10
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 1308 1427 1.0E-10
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 557 759 2.0E-10
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 557 769 2.0E-10
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 557 769 2.0E-10
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 557 759 2.0E-10
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 557 759 2.0E-10
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 557 759 2.0E-10
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 557 781 2.0E-10
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 697 1073 2.0E-10
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 518 735 2.0E-10
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 637 1151 2.0E-10
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 617 1110 2.0E-10
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 674 933 2.0E-10
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 663 1082 2.0E-10
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 518 735 2.0E-10
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 1308 1427 2.0E-10
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 612 1119 2.0E-10
sp|Q8BGA3|LRRT2_MOUSE Leucine-rich repeat transmembrane neuronal protein 2 OS=Mus musculus GN=Lrrtm2 PE=2 SV=1 783 1080 2.0E-10
sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 711 1060 2.0E-10
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 607 1082 2.0E-10
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 659 766 2.0E-10
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 638 1082 2.0E-10
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 624 788 2.0E-10
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 1299 1459 2.0E-10
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 556 765 3.0E-10
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 569 757 3.0E-10
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 557 781 3.0E-10
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 557 781 3.0E-10
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 607 919 3.0E-10
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 697 1073 3.0E-10
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 609 863 3.0E-10
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 620 786 3.0E-10
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 1308 1427 3.0E-10
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 594 769 3.0E-10
sp|D4A7P2|LRRT2_RAT Leucine-rich repeat transmembrane neuronal protein 2 OS=Rattus norvegicus GN=Lrrtm2 PE=1 SV=1 783 1080 3.0E-10
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 1233 1422 3.0E-10
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 664 864 3.0E-10
sp|O43300|LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens GN=LRRTM2 PE=2 SV=3 783 1080 3.0E-10
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 557 769 4.0E-10
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 556 765 4.0E-10
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 556 765 4.0E-10
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 570 773 4.0E-10
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 588 1079 4.0E-10
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 609 863 4.0E-10
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 598 769 4.0E-10
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 556 735 4.0E-10
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 1309 1461 4.0E-10
sp|D0ZRB2|SLRP_SALT1 E3 ubiquitin-protein ligase SlrP OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=slrP PE=1 SV=1 661 867 4.0E-10
sp|Q8ZQQ2|SLRP_SALTY E3 ubiquitin-protein ligase SlrP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=slrP PE=1 SV=1 661 867 4.0E-10
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 1305 1461 4.0E-10
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 690 1080 4.0E-10
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 569 747 5.0E-10
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 557 759 5.0E-10
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 569 747 5.0E-10
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 556 765 5.0E-10
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 607 919 5.0E-10
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 564 937 5.0E-10
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 1314 1462 5.0E-10
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 591 769 5.0E-10
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 569 747 6.0E-10
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 569 747 6.0E-10
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 569 747 6.0E-10
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 556 927 6.0E-10
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 570 790 6.0E-10
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 720 1084 6.0E-10
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 557 779 6.0E-10
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 544 766 7.0E-10
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 607 919 7.0E-10
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 552 850 7.0E-10
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 570 913 7.0E-10
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 1303 1425 7.0E-10
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 803 1157 8.0E-10
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 521 764 9.0E-10
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 570 773 9.0E-10
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 768 1084 9.0E-10
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 572 750 9.0E-10
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 569 747 1.0E-09
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 542 787 1.0E-09
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 697 1073 1.0E-09
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 834 1086 1.0E-09
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 557 1080 1.0E-09
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 640 929 1.0E-09
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 606 796 1.0E-09
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 641 962 1.0E-09
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 1244 1459 1.0E-09
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 577 1086 1.0E-09
sp|Q6AUQ4|P2C47_ORYSJ Probable protein phosphatase 2C 47 OS=Oryza sativa subsp. japonica GN=Os05g0134200 PE=2 SV=1 1308 1459 1.0E-09
sp|Q14392|LRC32_HUMAN Leucine-rich repeat-containing protein 32 OS=Homo sapiens GN=LRRC32 PE=1 SV=1 568 1061 1.0E-09
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 606 796 1.0E-09
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 1306 1464 1.0E-09
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 637 1080 1.0E-09
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 826 1090 2.0E-09
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 679 1080 2.0E-09
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 556 747 2.0E-09
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 606 779 2.0E-09
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 606 779 2.0E-09
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 606 779 2.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 668 1061 2.0E-09
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 568 940 2.0E-09
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 1210 1459 2.0E-09
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 633 933 2.0E-09
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 518 757 2.0E-09
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 580 756 2.0E-09
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 556 1086 2.0E-09
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 556 769 3.0E-09
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 777 1066 3.0E-09
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 825 1080 3.0E-09
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 557 1082 3.0E-09
sp|A6NIK2|LR10B_HUMAN Leucine-rich repeat-containing protein 10B OS=Homo sapiens GN=LRRC10B PE=4 SV=2 617 788 3.0E-09
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 692 1082 3.0E-09
sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 612 909 3.0E-09
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 836 1080 3.0E-09
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 1307 1463 3.0E-09
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 611 769 3.0E-09
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 620 786 3.0E-09
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 562 938 4.0E-09
sp|O08742|GPV_MOUSE Platelet glycoprotein V OS=Mus musculus GN=Gp5 PE=1 SV=1 730 1057 4.0E-09
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 566 757 4.0E-09
sp|Q5RF01|LRC32_PONAB Leucine-rich repeat-containing protein 32 OS=Pongo abelii GN=LRRC32 PE=2 SV=1 568 1061 4.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 775 1080 5.0E-09
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 518 769 5.0E-09
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 628 919 5.0E-09
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 713 1074 5.0E-09
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 557 936 5.0E-09
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 808 933 5.0E-09
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 570 757 5.0E-09
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 713 1075 5.0E-09
sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=1 SV=1 836 1080 5.0E-09
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 544 1109 5.0E-09
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 525 745 6.0E-09
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 628 919 6.0E-09
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 1322 1461 6.0E-09
sp|Q9LUU7|P2C43_ARATH Probable protein phosphatase 2C 43 OS=Arabidopsis thaliana GN=At3g17250 PE=2 SV=1 1305 1459 6.0E-09
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 816 1082 7.0E-09
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 628 919 7.0E-09
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 570 913 7.0E-09
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 1197 1458 7.0E-09
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 1307 1463 7.0E-09
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 543 765 8.0E-09
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 720 1110 8.0E-09
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 557 927 8.0E-09
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 567 756 8.0E-09
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 641 896 8.0E-09
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 606 796 8.0E-09
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 557 781 9.0E-09
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 809 934 9.0E-09
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 1309 1464 9.0E-09
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 826 1090 1.0E-08
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 826 1090 1.0E-08
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 826 1090 1.0E-08
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 557 790 1.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 564 781 1.0E-08
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 704 1082 1.0E-08
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 594 867 1.0E-08
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 569 756 1.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 518 757 1.0E-08
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 564 1146 1.0E-08
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 568 940 1.0E-08
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 664 790 1.0E-08
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 974 1080 1.0E-08
sp|Q3URE9|LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus GN=Lingo2 PE=2 SV=1 741 1080 1.0E-08
sp|D4AC13|LGR5_RAT Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Rattus norvegicus GN=Lgr5 PE=3 SV=1 713 1060 1.0E-08
sp|D4AC13|LGR5_RAT Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Rattus norvegicus GN=Lgr5 PE=3 SV=1 570 937 1.0E-08
sp|Q149C3|LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus GN=Lingo4 PE=2 SV=2 825 1062 1.0E-08
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 606 796 1.0E-08
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 796 933 1.0E-08
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 670 1011 1.0E-08
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 603 757 1.0E-08
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 661 927 1.0E-08
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 507 760 2.0E-08
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 729 933 2.0E-08
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 643 928 2.0E-08
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 567 867 2.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 564 729 2.0E-08
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 796 933 2.0E-08
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 576 779 2.0E-08
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 875 1074 2.0E-08
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 558 936 2.0E-08
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 611 909 2.0E-08
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 656 790 2.0E-08
sp|Q6K5I0|P2C20_ORYSJ Probable protein phosphatase 2C 20 OS=Oryza sativa subsp. japonica GN=Os02g0600000 PE=3 SV=2 1157 1478 2.0E-08
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 1299 1459 2.0E-08
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 603 1086 2.0E-08
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 870 1069 2.0E-08
sp|Q6UY18|LIGO4_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 OS=Homo sapiens GN=LINGO4 PE=2 SV=1 802 1062 2.0E-08
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 664 1082 2.0E-08
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 566 929 2.0E-08
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 617 1082 2.0E-08
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 882 1083 2.0E-08
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 679 1057 2.0E-08
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 620 786 2.0E-08
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 556 828 3.0E-08
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 798 1086 3.0E-08
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 628 929 3.0E-08
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 778 933 3.0E-08
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 870 1069 3.0E-08
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 1299 1459 3.0E-08
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 659 790 3.0E-08
sp|Q80ZD9|AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus GN=Amigo2 PE=1 SV=1 611 766 3.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 824 1082 4.0E-08
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 650 933 4.0E-08
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 548 747 4.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 556 747 4.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 798 933 4.0E-08
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 556 747 4.0E-08
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 681 1132 4.0E-08
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 815 1080 4.0E-08
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 664 1086 4.0E-08
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 269 4.0E-08
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 1301 1422 4.0E-08
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 621 1086 4.0E-08
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 1262 1466 4.0E-08
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 557 769 5.0E-08
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 834 1086 5.0E-08
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 685 934 5.0E-08
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 584 867 5.0E-08
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 881 1091 5.0E-08
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 618 810 5.0E-08
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 1309 1462 5.0E-08
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 516 750 5.0E-08
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 1299 1459 5.0E-08
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 826 957 5.0E-08
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 1307 1466 5.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 687 927 6.0E-08
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 840 1083 6.0E-08
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 552 937 6.0E-08
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 669 830 6.0E-08
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 1291 1435 6.0E-08
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 659 790 6.0E-08
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 650 933 7.0E-08
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 672 937 7.0E-08
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 850 933 7.0E-08
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 817 1091 7.0E-08
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 797 1082 8.0E-08
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 846 1082 8.0E-08
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 863 1082 8.0E-08
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 544 746 8.0E-08
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 681 1084 8.0E-08
sp|Q7L985|LIGO2_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Homo sapiens GN=LINGO2 PE=2 SV=1 741 1080 8.0E-08
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 870 1069 8.0E-08
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 774 1084 9.0E-08
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 835 933 9.0E-08
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 576 779 9.0E-08
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 614 932 9.0E-08
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 690 1078 9.0E-08
sp|P36047|SDS22_YEAST Protein phosphatase 1 regulatory subunit SDS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS22 PE=1 SV=1 647 884 9.0E-08
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 1304 1431 9.0E-08
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 557 1082 1.0E-07
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 687 1077 1.0E-07
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 799 940 1.0E-07
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 650 933 1.0E-07
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 534 764 1.0E-07
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 667 1059 1.0E-07
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 742 934 1.0E-07
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 544 929 1.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 812 934 1.0E-07
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 594 760 1.0E-07
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 1306 1462 1.0E-07
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 672 1082 1.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 612 743 1.0E-07
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 1326 1459 1.0E-07
sp|Q7TNJ4|AMGO2_RAT Amphoterin-induced protein 2 OS=Rattus norvegicus GN=Amigo2 PE=1 SV=1 611 769 1.0E-07
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 558 900 1.0E-07
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 566 743 1.0E-07
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 556 937 1.0E-07
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 564 930 1.0E-07
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 676 1080 1.0E-07
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 711 914 2.0E-07
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 569 1014 2.0E-07
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 556 764 2.0E-07
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 675 896 2.0E-07
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 548 747 2.0E-07
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 971 1083 2.0E-07
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 761 933 2.0E-07
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 549 750 2.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 730 933 2.0E-07
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 590 769 2.0E-07
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 563 759 2.0E-07
sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 661 1008 2.0E-07
sp|Q86SJ2|AMGO2_HUMAN Amphoterin-induced protein 2 OS=Homo sapiens GN=AMIGO2 PE=1 SV=1 611 766 2.0E-07
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 1309 1427 2.0E-07
sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=1 SV=1 1309 1466 2.0E-07
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 1309 1427 2.0E-07
sp|Q5R7M3|AMGO2_PONAB Amphoterin-induced protein 2 OS=Pongo abelii GN=AMIGO2 PE=2 SV=1 611 766 2.0E-07
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 1308 1462 2.0E-07
sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 669 839 2.0E-07
sp|Q32KX5|LRC28_BOVIN Leucine-rich repeat-containing protein 28 OS=Bos taurus GN=LRRC28 PE=2 SV=1 563 759 2.0E-07
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 825 1080 3.0E-07
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 681 1132 3.0E-07
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 556 735 3.0E-07
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 556 735 3.0E-07
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 564 988 3.0E-07
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 556 904 3.0E-07
sp|Q9Z1S7|OMD_RAT Osteomodulin OS=Rattus norvegicus GN=Omd PE=2 SV=1 696 935 3.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 621 927 3.0E-07
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 1308 1425 3.0E-07
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 826 1149 4.0E-07
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 685 913 4.0E-07
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 541 867 4.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 563 766 4.0E-07
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 810 948 4.0E-07
sp|Q6DF55|VASN_XENTR Vasorin OS=Xenopus tropicalis GN=vasn PE=2 SV=1 977 1082 4.0E-07
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 557 781 5.0E-07
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 557 831 5.0E-07
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 800 933 5.0E-07
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 851 1086 5.0E-07
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 855 1092 5.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 824 1085 5.0E-07
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 839 1058 5.0E-07
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 206 269 5.0E-07
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 269 5.0E-07
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 716 1082 5.0E-07
sp|Q28888|PGS2_RABIT Decorin OS=Oryctolagus cuniculus GN=DCN PE=2 SV=1 798 1064 5.0E-07
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 617 1082 5.0E-07
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 638 934 5.0E-07
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 591 785 5.0E-07
sp|Q9MYW3|TLR4_HORSE Toll-like receptor 4 OS=Equus caballus GN=TLR4 PE=2 SV=1 621 878 6.0E-07
sp|O74473|CDC11_SCHPO Septation initiation network scaffold protein cdc11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc11 PE=1 SV=1 684 1086 6.0E-07
sp|Q9TTE2|PGS2_SHEEP Decorin OS=Ovis aries GN=DCN PE=2 SV=1 616 886 6.0E-07
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 556 744 7.0E-07
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 899 1083 7.0E-07
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 899 1084 7.0E-07
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 612 1110 7.0E-07
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 556 735 7.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 622 1031 7.0E-07
sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus GN=DCN PE=1 SV=2 616 886 7.0E-07
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 661 930 7.0E-07
sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 563 839 7.0E-07
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 883 1073 8.0E-07
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 674 769 8.0E-07
sp|O70210|CHAD_RAT Chondroadherin OS=Rattus norvegicus GN=Chad PE=2 SV=1 572 786 8.0E-07
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 556 1066 8.0E-07
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 1233 1445 8.0E-07
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 713 933 9.0E-07
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 713 933 9.0E-07
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 899 1084 9.0E-07
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 713 1059 9.0E-07
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 707 1076 9.0E-07
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 556 930 9.0E-07
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 702 1076 9.0E-07
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 557 831 1.0E-06
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 524 802 1.0E-06
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 801 1038 1.0E-06
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 557 756 1.0E-06
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 720 1073 1.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 851 1082 1.0E-06
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 804 1084 1.0E-06
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 556 735 1.0E-06
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 839 1058 1.0E-06
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 667 788 1.0E-06
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 564 937 1.0E-06
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1308 1487 1.0E-06
sp|Q93373|LET4_CAEEL Leucine-rich repeat-containing protein let-4 OS=Caenorhabditis elegans GN=let-4 PE=2 SV=2 618 930 1.0E-06
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 524 766 1.0E-06
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 707 1076 1.0E-06
sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 664 938 1.0E-06
sp|Q96JA1|LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens GN=LRIG1 PE=1 SV=2 639 1029 1.0E-06
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 1315 1462 1.0E-06
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 628 1080 1.0E-06
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 1309 1425 1.0E-06
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 1309 1462 1.0E-06
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 690 927 1.0E-06
sp|Q5R1V9|PGS2_PANTR Decorin OS=Pan troglodytes GN=DCN PE=2 SV=1 798 1060 1.0E-06
sp|P07585|PGS2_HUMAN Decorin OS=Homo sapiens GN=DCN PE=1 SV=1 798 1060 1.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 476 867 2.0E-06
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 549 769 2.0E-06
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 799 933 2.0E-06
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 751 934 2.0E-06
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 824 1082 2.0E-06
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 564 727 2.0E-06
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 699 1088 2.0E-06
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 859 1083 2.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 666 890 2.0E-06
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 686 1079 2.0E-06
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 778 938 2.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 206 269 2.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 270 2.0E-06
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 599 795 2.0E-06
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 1308 1462 2.0E-06
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 1293 1426 2.0E-06
sp|P23515|OMGP_HUMAN Oligodendrocyte-myelin glycoprotein OS=Homo sapiens GN=OMG PE=1 SV=2 685 882 2.0E-06
sp|Q7Z5L7|PODN_HUMAN Podocan OS=Homo sapiens GN=PODN PE=1 SV=2 558 934 2.0E-06
sp|Q5R6B1|LRRT1_PONAB Leucine-rich repeat transmembrane neuronal protein 1 OS=Pongo abelii GN=LRRTM1 PE=2 SV=1 824 1057 2.0E-06
sp|O55226|CHAD_MOUSE Chondroadherin OS=Mus musculus GN=Chad PE=2 SV=1 572 786 2.0E-06
sp|P28654|PGS2_MOUSE Decorin OS=Mus musculus GN=Dcn PE=1 SV=1 616 883 2.0E-06
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 557 1011 2.0E-06
sp|Q86UE6|LRRT1_HUMAN Leucine-rich repeat transmembrane neuronal protein 1 OS=Homo sapiens GN=LRRTM1 PE=2 SV=2 824 1057 2.0E-06
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 671 1076 3.0E-06
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 881 1091 3.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 829 1085 3.0E-06
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 1003 1082 3.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 850 933 3.0E-06
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 797 933 3.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 810 933 3.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 618 757 3.0E-06
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 690 890 3.0E-06
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 618 791 3.0E-06
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 591 1070 3.0E-06
sp|Q9Z1S7|OMD_RAT Osteomodulin OS=Rattus norvegicus GN=Omd PE=2 SV=1 641 785 3.0E-06
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 589 912 3.0E-06
sp|Q96JA1|LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens GN=LRIG1 PE=1 SV=2 568 899 3.0E-06
sp|Q27972|CHAD_BOVIN Chondroadherin OS=Bos taurus GN=CHAD PE=1 SV=1 566 786 3.0E-06
sp|Q9XSD9|PGS2_PIG Decorin OS=Sus scrofa GN=DCN PE=2 SV=1 616 883 3.0E-06
sp|Q9QUK6|TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus GN=Tlr4 PE=1 SV=1 564 878 3.0E-06
sp|Q9BXR5|TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens GN=TLR10 PE=1 SV=2 621 1080 3.0E-06
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 1309 1468 3.0E-06
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 1233 1445 3.0E-06
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 1307 1459 3.0E-06
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 1307 1461 3.0E-06
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 663 783 3.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 863 1076 4.0E-06
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 686 1088 4.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 690 1073 4.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 790 934 4.0E-06
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 899 1084 4.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 978 1167 4.0E-06
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 678 1082 4.0E-06
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 674 876 4.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 208 269 4.0E-06
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 881 1091 4.0E-06
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 631 816 4.0E-06
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 643 909 4.0E-06
sp|Q29393|PGS2_CANLF Decorin OS=Canis lupus familiaris GN=DCN PE=2 SV=2 798 1062 4.0E-06
sp|B0BLW3|LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis GN=lgr4 PE=1 SV=1 671 1080 4.0E-06
sp|Q99983|OMD_HUMAN Osteomodulin OS=Homo sapiens GN=OMD PE=1 SV=1 733 935 4.0E-06
sp|Q99983|OMD_HUMAN Osteomodulin OS=Homo sapiens GN=OMD PE=1 SV=1 588 785 4.0E-06
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 671 1086 4.0E-06
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 561 839 5.0E-06
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 675 896 5.0E-06
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 543 748 5.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 801 1083 5.0E-06
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 682 1181 5.0E-06
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 992 1084 5.0E-06
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 793 957 5.0E-06
sp|Q9TTE2|PGS2_SHEEP Decorin OS=Ovis aries GN=DCN PE=2 SV=1 798 1062 5.0E-06
sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus GN=DCN PE=1 SV=2 798 1062 5.0E-06
sp|Q9XSD9|PGS2_PIG Decorin OS=Sus scrofa GN=DCN PE=2 SV=1 798 1062 5.0E-06
sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=2 SV=1 656 1013 5.0E-06
sp|P0CE12|SSPH2_SALTY E3 ubiquitin-protein ligase sspH2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sspH2 PE=1 SV=1 829 1063 5.0E-06
sp|D0ZPH9|SSPH2_SALT1 E3 ubiquitin-protein ligase sspH2 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=sspH2 PE=1 SV=1 829 1063 5.0E-06
sp|Q7L0X0|TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens GN=TRIL PE=1 SV=2 836 1109 5.0E-06
sp|O46542|PGS2_HORSE Decorin OS=Equus caballus GN=DCN PE=2 SV=1 798 1062 5.0E-06
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 674 769 5.0E-06
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 1307 1461 5.0E-06
sp|O94769|ECM2_HUMAN Extracellular matrix protein 2 OS=Homo sapiens GN=ECM2 PE=2 SV=1 798 1127 5.0E-06
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 858 1083 6.0E-06
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 815 1050 6.0E-06
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 628 888 6.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 801 967 6.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 508 747 6.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 667 788 6.0E-06
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 1307 1461 6.0E-06
sp|P02750|A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens GN=LRG1 PE=1 SV=2 894 1082 6.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 556 929 7.0E-06
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 992 1084 7.0E-06
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 568 1093 7.0E-06
sp|A4IIW9|LIGO1_XENTR Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Xenopus tropicalis GN=lingo1 PE=2 SV=1 639 932 7.0E-06
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 1308 1462 7.0E-06
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 872 1044 7.0E-06
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 671 1091 8.0E-06
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 713 1063 8.0E-06
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 729 933 8.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 713 930 8.0E-06
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 826 933 8.0E-06
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 563 745 8.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 269 8.0E-06
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 1003 1082 8.0E-06
sp|Q8Y3L4|INLJ_LISMO Internalin-J OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlJ PE=1 SV=1 706 912 8.0E-06
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 975 1082 9.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 974 1082 9.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 570 747 9.0E-06
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 801 967 9.0E-06
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 690 772 9.0E-06
sp|Q9TSP2|TLR4_PAPAN Toll-like receptor 4 OS=Papio anubis GN=TLR4 PE=3 SV=1 555 931 9.0E-06
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 1308 1447 9.0E-06
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 628 929 9.0E-06
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 971 1099 1.0E-05
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 980 1185 1.0E-05
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 674 769 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0009190 cyclic nucleotide biosynthetic process Yes
GO:0035556 intracellular signal transduction Yes
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0009117 nucleotide metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:1901360 organic cyclic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009187 cyclic nucleotide metabolic process No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0009165 nucleotide biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0044281 small molecule metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No
GO:0016791 phosphatase activity No
GO:0009058 biosynthetic process No
GO:0007165 signal transduction No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|038940
MTIAAVGVSSEVRLQIDDLIDDRGQVIEDVLADPQLAQMGPIDPTIAPFLVDEPPSPASTTFLPAPDHERSPSHS
FTSSKGFSKSSFTSFLSFRQSSSASRSFRASDSTAHLPSPDSKHRSSYDDWDASTVNSSTTQQTELRKKSSMFNI
LKRKASKVHLRHTSQEDSPPPPVPPKPADNYVFNLPVDPPHPFVQPPPSLHHPSSSKDKGKGKEKEREREQERDR
EREREKEKEKDRDRDRDRDKDRDKDGEKSREKDKEKKSKKRRIKGPPVPPKDDPLFPLDTNLDRMEGIVSAENLI
PLTNHAPENSLTDPPTFNNPFSSSDPQAGAINYGPSHISPTASMPFLNGQTPDPKEARPSFSTIRKDDGEWVTPQ
SWIVVGKDDTKDDMTAPDDDVSTDDETRAKSGPNSIIQSSLHPPSFRIGGSIKPSRRDKTREGKDELVMKIYRPN
GAPIQTAMGISLTVYDLIPTLLKRMVGDERRLNRLFLMERGKERIMDIRELPLNLICRRMTEAGYSWNDGRILLS
GDRLAFLLKFIFRDPDMGLGRRSLTADAPYQIPESELRLHNFETLDLSGRSLRTIPVALHQHADQIISLKLSRNP
MIDLPLDFVEACTSLCDLRLSNMSMRKIPANLVAAKALKRLDLSSNHIKIKELENANLQLIPELRGLLLHNNLLK
DLPQKFADFENLLNLNISSNRLPTIPDVVLQIKTLTELDVSFNYITDLPTNVGDMTSLQRFLFVGNSIKSIPNSF
WKLRNLEHVDCRRNQIGDLGIVMNLPRLETLNADHNAIHLLDLSMGKHVMKIDLSNNEITKVMVSLPPFGSTSLQ
LTTLDVSYASLTTLDGAVLRNLPTLVTLRIQHNSLAYLPDSIEELVHLETFICYENRLQRLPDTIGKLSKLITLD
AHSNNLREVPVAIWQCPSLCILNLSSNFLTTFPVPPLIPLYPMPDQTGRIADPPKNYDASHVISSILHPPLMFSL
ENLSISENKISSIDSLRNISFFRSLLSLNLSYNDISDLPKGFFRKMYRLEEFHICGNDLTMIPGHEEFSNLRELR
RLFLSGNKLTSLPAELGRLKRLKVMDVSNNCLRYNINNYGYDWNWNNNEDLYYLNLSGNKRFQVKRDNRHTFGSS
RSSRELHNPLSGFSSVPKLRILGLMDVTVTASDLPDEHEDRRVRSTSSLVGGLGYGIADSLNIDDSMTMLDLVHE
FPPINGTSRALFAMFGNAKPPKLPIGVSPNKHAKFLHDHFIPFFQNQLDHPYLQESNHFAVDVLRRSFLGLHQTI
HDMWFPPVQRKASMASVAGGLPTVNVDSGTARTGCSGLVVYIEGNRLFAANVGSAHGVISRKGQPFLVTRIHCPW
DEDELKRMRKSEGWVSPEGLVNNEVDVSRSFGYYQLLPVVNASPDIVEYEISETDEYLVLGNRALWDFVSYQTAV
DIASGRGEPSMIAQKLRDFAISYGSTGNIMVMVVRLKDYHERPLVRTPSMIESDSPFSPALYIPKSNHMVVDKSV
RRAEPEVPPPTGHIALVFTDIRNSTHLWEVNPGMPAAIQIHNDLMRRRLRECGGYEFKTEGDAFLCSFPTIMAAV
WFCLSVQNQLLQENWPKEILECEDGKAIVDSEGNMLWKGISVRMGIHSGTPVCLQDPVTHRMDYYGPVINRAARV
SALAKGGQIFCSAEVVQEIKASVLEAIEKTSLSKSQPAKAIAEVKQLGVIIKEVGEMKLKGLEVPEFISAIYTPG
LEGRHDFDAEEDPAPASVYLDVAHVREIGMLCLRLEALTSGRIFKPSNTARDLNLTIPLEDDPEDEDNPELWRDL
EVDPENLLPPMTTRWTDHDLLTTLDSFTCRIQNALQTLIKAYEADRINAPNIMNVLSNAGLDADTLLVMAELIGH
S*
Coding >Agabi119p4|038940
ATGACCATCGCCGCCGTCGGCGTCAGCAGCGAGGTGAGGCTGCAGATAGACGATCTCATCGACGACCGCGGACAG
GTCATTGAGGATGTTCTCGCCGACCCGCAACTCGCACAGATGGGCCCCATTGACCCAACAATTGCACCATTCCTC
GTGGACGAGCCTCCATCTCCTGCCTCGACGACGTTTCTGCCGGCGCCGGACCATGAGCGCTCGCCGTCGCACTCG
TTCACATCCTCCAAAGGCTTTTCCAAATCCTCCTTCACCTCCTTCCTCTCCTTCCGCCAGAGTAGTTCCGCCAGC
AGGTCTTTCCGTGCCTCGGACTCGACAGCACATCTCCCCAGTCCGGACTCTAAGCATCGATCTTCCTATGACGAC
TGGGACGCCTCTACCGTCAACTCGTCTACCACTCAGCAGACTGAGCTCCGCAAGAAGAGCTCCATGTTTAATATC
CTCAAGCGCAAGGCGAGCAAGGTGCATCTTCGCCATACCTCTCAGGAAGATAGTCCACCGCCACCCGTACCCCCC
AAACCTGCTGACAATTATGTATTCAACCTTCCTGTCGATCCTCCGCATCCCTTCGTCCAACCCCCTCCATCCCTA
CACCACCCCAGCTCTTCAAAGGATAAAGGGAAGGGCAAGGAAAAAGAAAGAGAAAGAGAGCAAGAACGAGACAGG
GAGAGAGAGAGAGAGAAAGAAAAAGAAAAGGACAGGGACAGGGACAGGGATAGGGATAAAGACCGGGACAAAGAC
GGGGAAAAGTCGAGGGAGAAAGACAAAGAAAAAAAGAGCAAGAAGAGGCGCATCAAAGGTCCACCAGTTCCACCA
AAAGATGATCCTCTCTTTCCTCTTGACACCAACCTGGATCGCATGGAGGGTATCGTTTCTGCAGAAAACCTGATT
CCTCTTACAAATCACGCACCTGAAAACTCATTGACGGATCCACCCACTTTCAACAACCCCTTCTCTTCCTCCGAC
CCCCAGGCAGGCGCCATAAATTATGGTCCCTCACATATATCGCCGACAGCCTCCATGCCCTTCCTCAACGGTCAA
ACTCCTGATCCTAAAGAAGCCAGGCCCTCCTTTTCTACTATACGAAAAGACGATGGCGAATGGGTAACACCTCAG
AGTTGGATCGTCGTAGGTAAAGACGATACGAAAGACGACATGACCGCTCCCGACGACGACGTATCGACCGACGAC
GAAACGCGAGCAAAGAGCGGTCCGAACAGTATCATTCAGAGCAGCCTTCATCCACCGAGTTTCCGTATTGGCGGA
TCGATAAAACCGTCAAGAAGGGACAAAACCAGAGAAGGGAAAGATGAACTTGTTATGAAGATTTACCGCCCGAAT
GGTGCCCCCATTCAGACTGCAATGGGTATCAGTTTGACGGTATATGATTTGATACCAACGCTGCTCAAAAGAATG
GTTGGAGATGAAAGGCGTTTGAATCGGTTGTTTCTAATGGAACGTGGAAAGGAGCGCATCATGGATATCAGAGAA
TTACCCCTCAATCTTATTTGTCGTCGAATGACGGAAGCTGGATATTCATGGAACGATGGTCGGATTCTTCTCAGC
GGCGATCGTCTAGCCTTTCTTCTCAAATTCATCTTCCGAGATCCAGACATGGGACTCGGTCGTCGATCACTCACC
GCCGACGCCCCATACCAAATCCCCGAAAGCGAACTTCGACTACACAATTTTGAAACTCTCGATCTGTCAGGTCGA
AGTCTACGTACTATCCCCGTCGCCCTACATCAACACGCTGATCAAATCATTTCATTGAAACTTTCCCGAAATCCG
ATGATTGATTTACCTTTGGATTTTGTAGAGGCTTGTACGTCGTTATGTGACTTGCGGCTGTCCAATATGTCGATG
CGGAAGATTCCTGCAAATTTGGTTGCGGCTAAGGCGTTGAAGAGACTGGACCTTTCGTCGAACCATATCAAGATC
AAAGAACTCGAGAATGCGAATTTGCAACTTATACCGGAGCTGAGGGGGTTGCTGTTGCATAACAACCTGCTCAAG
GATCTACCGCAGAAGTTTGCTGATTTCGAAAATCTACTGAATCTCAATATCTCGAGTAATCGGTTACCGACGATA
CCGGATGTTGTGTTACAGATCAAGACACTCACCGAGCTCGATGTTTCCTTCAATTACATCACTGACCTTCCAACC
AATGTTGGTGATATGACGAGTTTGCAACGGTTTTTGTTCGTCGGCAACTCCATCAAAAGTATTCCTAATAGCTTT
TGGAAACTACGCAATCTGGAGCATGTTGATTGTCGAAGAAATCAAATTGGGGATTTGGGTATCGTGATGAATTTG
CCTCGGCTCGAGACATTGAACGCCGATCATAATGCCATTCACCTACTCGACCTCTCTATGGGAAAACATGTCATG
AAAATTGATCTGTCGAATAACGAGATTACGAAAGTCATGGTTTCGTTACCGCCTTTTGGTTCGACATCACTTCAA
CTTACGACCTTGGACGTTTCGTATGCGAGTTTGACGACATTGGATGGGGCGGTTTTGCGTAACCTTCCGACATTG
GTCACTCTTCGAATTCAACACAATTCCCTTGCCTATCTACCTGATTCTATCGAAGAACTCGTTCACCTGGAAACC
TTCATCTGTTATGAAAATCGATTACAACGACTTCCGGATACCATTGGCAAACTTTCAAAATTGATTACCTTGGAT
GCGCATAGCAATAACCTTCGTGAAGTTCCTGTTGCAATCTGGCAATGCCCTTCGCTGTGTATACTTAATCTTTCA
TCAAACTTTCTAACGACTTTTCCTGTACCGCCATTAATTCCTTTATACCCCATGCCGGATCAAACAGGTCGTATA
GCTGACCCGCCAAAAAATTATGATGCTTCGCACGTCATTTCAAGTATCCTCCATCCGCCACTCATGTTCTCCCTC
GAAAATCTCTCTATATCCGAAAACAAAATTTCGTCAATCGACAGTCTACGCAATATCTCATTTTTCCGTTCCCTG
CTCTCATTAAACCTCTCTTACAATGATATCAGCGATTTGCCCAAAGGGTTCTTTCGAAAGATGTATAGGTTGGAG
GAGTTTCATATTTGTGGGAACGATTTGACTATGATTCCTGGTCATGAGGAATTTAGCAATTTGAGGGAGTTGAGG
AGGTTGTTTTTGAGTGGGAATAAATTGACGAGTTTGCCGGCGGAGTTGGGGAGGTTGAAGAGGTTGAAGGTGATG
GATGTGAGCAATAATTGTTTGAGGTATAATATTAATAATTATGGATATGATTGGAATTGGAACAATAACGAGGAC
CTTTATTATCTCAATTTATCGGGAAACAAGCGGTTCCAGGTGAAACGTGACAATCGACATACGTTTGGATCTTCG
AGGAGCAGTCGTGAACTCCATAACCCTCTTTCTGGATTTTCGAGTGTGCCCAAGTTACGGATTCTGGGATTGATG
GACGTTACGGTCACCGCTAGTGATCTTCCAGATGAACATGAGGATCGTCGAGTTCGTTCCACGTCTTCTCTCGTT
GGGGGTCTTGGATACGGTATCGCCGACAGTCTGAATATAGATGACTCGATGACAATGCTCGACCTCGTACATGAA
TTTCCTCCTATCAATGGTACCAGTCGTGCCTTGTTCGCCATGTTTGGTAATGCCAAACCGCCGAAACTCCCAATA
GGCGTCTCACCCAACAAGCATGCGAAATTCCTCCACGATCATTTTATTCCCTTTTTTCAAAACCAATTGGATCAT
CCGTATTTGCAAGAAAGTAATCATTTTGCGGTGGATGTTTTGAGGAGATCATTTTTGGGGTTGCATCAGACGATA
CATGATATGTGGTTTCCACCGGTTCAGAGGAAAGCGTCTATGGCGAGTGTGGCTGGTGGTTTACCGACTGTGAAT
GTCGATTCTGGGACTGCTAGGACGGGTTGTTCGGGTTTGGTGGTTTATATTGAGGGGAACAGATTGTTTGCGGCG
AATGTGGGTTCGGCACATGGTGTTATTTCGAGGAAGGGTCAACCGTTTTTGGTTACAAGGATTCATTGTCCTTGG
GATGAAGATGAATTGAAGAGGATGAGGAAGTCGGAAGGTTGGGTGTCACCTGAAGGATTGGTGAATAATGAAGTT
GACGTTTCGAGGTCGTTTGGCTATTATCAACTTTTACCCGTCGTCAATGCTTCTCCTGACATCGTGGAATACGAG
ATTTCGGAGACGGATGAGTATTTGGTTTTGGGGAATAGGGCTTTGTGGGACTTTGTGAGCTACCAGACGGCGGTG
GATATCGCTAGTGGGAGAGGTGAACCTTCGATGATTGCGCAGAAGTTGAGAGATTTTGCGATAAGCTATGGATCG
ACGGGCAATATTATGGTGATGGTGGTGAGGCTGAAGGATTATCATGAAAGGCCCCTCGTTCGGACACCGTCGATG
ATTGAATCGGATTCACCCTTCTCTCCGGCCTTGTATATCCCCAAATCGAATCATATGGTGGTGGACAAGAGTGTA
CGACGAGCCGAACCAGAAGTCCCTCCACCAACAGGTCATATCGCGTTGGTATTCACTGACATCCGGAATTCAACT
CATTTATGGGAAGTGAACCCCGGTATGCCAGCGGCCATTCAAATCCACAATGATTTGATGAGGAGACGATTGAGG
GAATGTGGTGGGTACGAATTCAAAACAGAAGGAGACGCCTTTTTGTGCAGTTTTCCGACTATCATGGCTGCTGTG
TGGTTCTGTCTTTCGGTGCAGAATCAATTATTACAGGAGAACTGGCCAAAGGAGATTTTAGAATGCGAGGATGGG
AAGGCTATCGTGGATTCGGAGGGGAATATGCTTTGGAAAGGTATCTCGGTCAGGATGGGTATCCATAGTGGGACG
CCAGTGTGTTTGCAGGATCCTGTGACGCATAGGATGGATTATTATGGTCCGGTTATTAATCGAGCGGCGAGGGTT
AGTGCATTGGCGAAGGGAGGACAGATTTTTTGTAGTGCGGAGGTGGTACAAGAGATCAAGGCATCGGTTTTGGAG
GCTATAGAAAAGACGTCTCTGTCGAAATCACAACCTGCAAAAGCGATCGCGGAAGTCAAGCAATTGGGGGTCATT
ATCAAGGAGGTCGGAGAGATGAAACTCAAGGGTTTGGAGGTACCTGAATTTATTTCAGCGATTTATACCCCGGGA
CTGGAGGGCAGACATGATTTCGACGCGGAGGAAGATCCTGCACCTGCGAGCGTATACTTGGATGTTGCTCATGTA
CGCGAGATAGGTATGTTGTGTCTTCGACTGGAGGCGTTGACATCTGGACGGATATTCAAACCTTCAAATACCGCG
AGGGACCTGAATTTGACCATTCCTCTCGAGGATGATCCTGAAGACGAAGACAACCCTGAGCTATGGAGAGATCTG
GAGGTGGATCCTGAAAACCTGTTACCTCCGATGACGACGAGATGGACTGATCATGACCTCCTCACGACGCTGGAC
TCATTTACTTGTCGAATTCAGAACGCCCTTCAGACGCTTATCAAGGCATACGAAGCGGATCGAATTAATGCACCG
AATATCATGAATGTTCTCAGTAATGCTGGACTCGATGCTGATACGTTACTGGTCATGGCAGAACTTATTGGACAT
TCTTAA
Transcript >Agabi119p4|038940
ATGACCATCGCCGCCGTCGGCGTCAGCAGCGAGGTGAGGCTGCAGATAGACGATCTCATCGACGACCGCGGACAG
GTCATTGAGGATGTTCTCGCCGACCCGCAACTCGCACAGATGGGCCCCATTGACCCAACAATTGCACCATTCCTC
GTGGACGAGCCTCCATCTCCTGCCTCGACGACGTTTCTGCCGGCGCCGGACCATGAGCGCTCGCCGTCGCACTCG
TTCACATCCTCCAAAGGCTTTTCCAAATCCTCCTTCACCTCCTTCCTCTCCTTCCGCCAGAGTAGTTCCGCCAGC
AGGTCTTTCCGTGCCTCGGACTCGACAGCACATCTCCCCAGTCCGGACTCTAAGCATCGATCTTCCTATGACGAC
TGGGACGCCTCTACCGTCAACTCGTCTACCACTCAGCAGACTGAGCTCCGCAAGAAGAGCTCCATGTTTAATATC
CTCAAGCGCAAGGCGAGCAAGGTGCATCTTCGCCATACCTCTCAGGAAGATAGTCCACCGCCACCCGTACCCCCC
AAACCTGCTGACAATTATGTATTCAACCTTCCTGTCGATCCTCCGCATCCCTTCGTCCAACCCCCTCCATCCCTA
CACCACCCCAGCTCTTCAAAGGATAAAGGGAAGGGCAAGGAAAAAGAAAGAGAAAGAGAGCAAGAACGAGACAGG
GAGAGAGAGAGAGAGAAAGAAAAAGAAAAGGACAGGGACAGGGACAGGGATAGGGATAAAGACCGGGACAAAGAC
GGGGAAAAGTCGAGGGAGAAAGACAAAGAAAAAAAGAGCAAGAAGAGGCGCATCAAAGGTCCACCAGTTCCACCA
AAAGATGATCCTCTCTTTCCTCTTGACACCAACCTGGATCGCATGGAGGGTATCGTTTCTGCAGAAAACCTGATT
CCTCTTACAAATCACGCACCTGAAAACTCATTGACGGATCCACCCACTTTCAACAACCCCTTCTCTTCCTCCGAC
CCCCAGGCAGGCGCCATAAATTATGGTCCCTCACATATATCGCCGACAGCCTCCATGCCCTTCCTCAACGGTCAA
ACTCCTGATCCTAAAGAAGCCAGGCCCTCCTTTTCTACTATACGAAAAGACGATGGCGAATGGGTAACACCTCAG
AGTTGGATCGTCGTAGGTAAAGACGATACGAAAGACGACATGACCGCTCCCGACGACGACGTATCGACCGACGAC
GAAACGCGAGCAAAGAGCGGTCCGAACAGTATCATTCAGAGCAGCCTTCATCCACCGAGTTTCCGTATTGGCGGA
TCGATAAAACCGTCAAGAAGGGACAAAACCAGAGAAGGGAAAGATGAACTTGTTATGAAGATTTACCGCCCGAAT
GGTGCCCCCATTCAGACTGCAATGGGTATCAGTTTGACGGTATATGATTTGATACCAACGCTGCTCAAAAGAATG
GTTGGAGATGAAAGGCGTTTGAATCGGTTGTTTCTAATGGAACGTGGAAAGGAGCGCATCATGGATATCAGAGAA
TTACCCCTCAATCTTATTTGTCGTCGAATGACGGAAGCTGGATATTCATGGAACGATGGTCGGATTCTTCTCAGC
GGCGATCGTCTAGCCTTTCTTCTCAAATTCATCTTCCGAGATCCAGACATGGGACTCGGTCGTCGATCACTCACC
GCCGACGCCCCATACCAAATCCCCGAAAGCGAACTTCGACTACACAATTTTGAAACTCTCGATCTGTCAGGTCGA
AGTCTACGTACTATCCCCGTCGCCCTACATCAACACGCTGATCAAATCATTTCATTGAAACTTTCCCGAAATCCG
ATGATTGATTTACCTTTGGATTTTGTAGAGGCTTGTACGTCGTTATGTGACTTGCGGCTGTCCAATATGTCGATG
CGGAAGATTCCTGCAAATTTGGTTGCGGCTAAGGCGTTGAAGAGACTGGACCTTTCGTCGAACCATATCAAGATC
AAAGAACTCGAGAATGCGAATTTGCAACTTATACCGGAGCTGAGGGGGTTGCTGTTGCATAACAACCTGCTCAAG
GATCTACCGCAGAAGTTTGCTGATTTCGAAAATCTACTGAATCTCAATATCTCGAGTAATCGGTTACCGACGATA
CCGGATGTTGTGTTACAGATCAAGACACTCACCGAGCTCGATGTTTCCTTCAATTACATCACTGACCTTCCAACC
AATGTTGGTGATATGACGAGTTTGCAACGGTTTTTGTTCGTCGGCAACTCCATCAAAAGTATTCCTAATAGCTTT
TGGAAACTACGCAATCTGGAGCATGTTGATTGTCGAAGAAATCAAATTGGGGATTTGGGTATCGTGATGAATTTG
CCTCGGCTCGAGACATTGAACGCCGATCATAATGCCATTCACCTACTCGACCTCTCTATGGGAAAACATGTCATG
AAAATTGATCTGTCGAATAACGAGATTACGAAAGTCATGGTTTCGTTACCGCCTTTTGGTTCGACATCACTTCAA
CTTACGACCTTGGACGTTTCGTATGCGAGTTTGACGACATTGGATGGGGCGGTTTTGCGTAACCTTCCGACATTG
GTCACTCTTCGAATTCAACACAATTCCCTTGCCTATCTACCTGATTCTATCGAAGAACTCGTTCACCTGGAAACC
TTCATCTGTTATGAAAATCGATTACAACGACTTCCGGATACCATTGGCAAACTTTCAAAATTGATTACCTTGGAT
GCGCATAGCAATAACCTTCGTGAAGTTCCTGTTGCAATCTGGCAATGCCCTTCGCTGTGTATACTTAATCTTTCA
TCAAACTTTCTAACGACTTTTCCTGTACCGCCATTAATTCCTTTATACCCCATGCCGGATCAAACAGGTCGTATA
GCTGACCCGCCAAAAAATTATGATGCTTCGCACGTCATTTCAAGTATCCTCCATCCGCCACTCATGTTCTCCCTC
GAAAATCTCTCTATATCCGAAAACAAAATTTCGTCAATCGACAGTCTACGCAATATCTCATTTTTCCGTTCCCTG
CTCTCATTAAACCTCTCTTACAATGATATCAGCGATTTGCCCAAAGGGTTCTTTCGAAAGATGTATAGGTTGGAG
GAGTTTCATATTTGTGGGAACGATTTGACTATGATTCCTGGTCATGAGGAATTTAGCAATTTGAGGGAGTTGAGG
AGGTTGTTTTTGAGTGGGAATAAATTGACGAGTTTGCCGGCGGAGTTGGGGAGGTTGAAGAGGTTGAAGGTGATG
GATGTGAGCAATAATTGTTTGAGGTATAATATTAATAATTATGGATATGATTGGAATTGGAACAATAACGAGGAC
CTTTATTATCTCAATTTATCGGGAAACAAGCGGTTCCAGGTGAAACGTGACAATCGACATACGTTTGGATCTTCG
AGGAGCAGTCGTGAACTCCATAACCCTCTTTCTGGATTTTCGAGTGTGCCCAAGTTACGGATTCTGGGATTGATG
GACGTTACGGTCACCGCTAGTGATCTTCCAGATGAACATGAGGATCGTCGAGTTCGTTCCACGTCTTCTCTCGTT
GGGGGTCTTGGATACGGTATCGCCGACAGTCTGAATATAGATGACTCGATGACAATGCTCGACCTCGTACATGAA
TTTCCTCCTATCAATGGTACCAGTCGTGCCTTGTTCGCCATGTTTGGTAATGCCAAACCGCCGAAACTCCCAATA
GGCGTCTCACCCAACAAGCATGCGAAATTCCTCCACGATCATTTTATTCCCTTTTTTCAAAACCAATTGGATCAT
CCGTATTTGCAAGAAAGTAATCATTTTGCGGTGGATGTTTTGAGGAGATCATTTTTGGGGTTGCATCAGACGATA
CATGATATGTGGTTTCCACCGGTTCAGAGGAAAGCGTCTATGGCGAGTGTGGCTGGTGGTTTACCGACTGTGAAT
GTCGATTCTGGGACTGCTAGGACGGGTTGTTCGGGTTTGGTGGTTTATATTGAGGGGAACAGATTGTTTGCGGCG
AATGTGGGTTCGGCACATGGTGTTATTTCGAGGAAGGGTCAACCGTTTTTGGTTACAAGGATTCATTGTCCTTGG
GATGAAGATGAATTGAAGAGGATGAGGAAGTCGGAAGGTTGGGTGTCACCTGAAGGATTGGTGAATAATGAAGTT
GACGTTTCGAGGTCGTTTGGCTATTATCAACTTTTACCCGTCGTCAATGCTTCTCCTGACATCGTGGAATACGAG
ATTTCGGAGACGGATGAGTATTTGGTTTTGGGGAATAGGGCTTTGTGGGACTTTGTGAGCTACCAGACGGCGGTG
GATATCGCTAGTGGGAGAGGTGAACCTTCGATGATTGCGCAGAAGTTGAGAGATTTTGCGATAAGCTATGGATCG
ACGGGCAATATTATGGTGATGGTGGTGAGGCTGAAGGATTATCATGAAAGGCCCCTCGTTCGGACACCGTCGATG
ATTGAATCGGATTCACCCTTCTCTCCGGCCTTGTATATCCCCAAATCGAATCATATGGTGGTGGACAAGAGTGTA
CGACGAGCCGAACCAGAAGTCCCTCCACCAACAGGTCATATCGCGTTGGTATTCACTGACATCCGGAATTCAACT
CATTTATGGGAAGTGAACCCCGGTATGCCAGCGGCCATTCAAATCCACAATGATTTGATGAGGAGACGATTGAGG
GAATGTGGTGGGTACGAATTCAAAACAGAAGGAGACGCCTTTTTGTGCAGTTTTCCGACTATCATGGCTGCTGTG
TGGTTCTGTCTTTCGGTGCAGAATCAATTATTACAGGAGAACTGGCCAAAGGAGATTTTAGAATGCGAGGATGGG
AAGGCTATCGTGGATTCGGAGGGGAATATGCTTTGGAAAGGTATCTCGGTCAGGATGGGTATCCATAGTGGGACG
CCAGTGTGTTTGCAGGATCCTGTGACGCATAGGATGGATTATTATGGTCCGGTTATTAATCGAGCGGCGAGGGTT
AGTGCATTGGCGAAGGGAGGACAGATTTTTTGTAGTGCGGAGGTGGTACAAGAGATCAAGGCATCGGTTTTGGAG
GCTATAGAAAAGACGTCTCTGTCGAAATCACAACCTGCAAAAGCGATCGCGGAAGTCAAGCAATTGGGGGTCATT
ATCAAGGAGGTCGGAGAGATGAAACTCAAGGGTTTGGAGGTACCTGAATTTATTTCAGCGATTTATACCCCGGGA
CTGGAGGGCAGACATGATTTCGACGCGGAGGAAGATCCTGCACCTGCGAGCGTATACTTGGATGTTGCTCATGTA
CGCGAGATAGGTATGTTGTGTCTTCGACTGGAGGCGTTGACATCTGGACGGATATTCAAACCTTCAAATACCGCG
AGGGACCTGAATTTGACCATTCCTCTCGAGGATGATCCTGAAGACGAAGACAACCCTGAGCTATGGAGAGATCTG
GAGGTGGATCCTGAAAACCTGTTACCTCCGATGACGACGAGATGGACTGATCATGACCTCCTCACGACGCTGGAC
TCATTTACTTGTCGAATTCAGAACGCCCTTCAGACGCTTATCAAGGCATACGAAGCGGATCGAATTAATGCACCG
AATATCATGAATGTTCTCAGTAATGCTGGACTCGATGCTGATACGTTACTGGTCATGGCAGAACTTATTGGACAT
TCTTAA
Gene >Agabi119p4|038940
ATGACCATCGCCGCCGTCGGCGTCAGCAGCGAGGTGAGGCTGCAGATAGACGATCTCATCGACGACCGCGGACAG
GTCATTGAGGATGTTCTCGCCGACCCGCAACTCGCACAGATGGGCCCCATTGACCCAACAATTGCACCATTCCTC
GTGGACGAGCCTGTGTGTCGACTTTTGCTGCTCTTTCCAATGACTGACGCTGTTTGCGTATAGCCATCTCCTGCC
TCGACGACGTTTCTGCCGGCGCCGGACCATGAGCGCTCGCCGTCGCACTCGTTCACATCCTCCAAAGGCTTTTCC
AAATCCTCCTTCACCTCCTTCCTCTCCTTCCGCCAGAGTAGTTCCGCCAGCAGGTCTTTCCGTGCCTCGGACTCG
ACAGCACATCTCCCCAGTCCGGACTCTAAGCATCGATCTTCCTATGACGACTGGGACGCCTCTACCGTCAACTCG
TCTACCACTCAGCAGACTGAGCTCCGCAAGAAGAGCTCCATGTTTAATATCCTCAAGCGCAAGGCGAGCAAGGTG
CATCTTCGCCATACCTCTCAGGAAGATAGTCCACCGCCACCCGTACCCCCCAAACCTGCTGACAATTATGTATTC
AACCTTCCTGTCGATCCTCCGCATCCCTTCGTCCAACCCCCTCCATCCCTACACCACCCCAGCTCTTCAAAGGAT
AAAGGGAAGGGCAAGGAAAAAGAAAGAGAAAGAGAGCAAGAACGAGACAGGGAGAGAGAGAGAGAGAAAGAAAAA
GAAAAGGACAGGGACAGGGACAGGGATAGGGATAAAGACCGGGACAAAGACGGGGAAAAGTCGAGGGAGAAAGAC
AAAGAAAAAAAGAGCAAGAAGAGGCGCATCAAAGGTCCACCAGTTCCACCAAAAGATGATCCTCTCTTTCCTCTT
GACACCAACCTGGATCGCATGGAGGGTATCGTTTCTGCAGAAAACCTGATTCCTCTTACAAATCACGCACCTGAA
AACTCATTGACGGATCCACCCACTTTCAACAACCCCTTCTCTTCCTCCGACCCCCAGGCAGGCGCCATAAATTAT
GGTCCCTCACATATATCGCCGACAGCCTCCATGCCCTTCCTCAACGGTCAAACTCCTGATCCTAAAGAAGCCAGG
CCCTCCTTTTCTACTATACGAAAAGACGATGGCGAATGGGTAACACCTCAGAGTTGGATCGTCGTAGGTAAAGAC
GATACGAAAGACGACATGACCGCTCCCGACGACGACGTATCGACCGACGACGAAACGCGAGCAAAGAGCGGTCCG
AACAGTATCATTCAGAGCAGCCTTCATCCACCGAGTTTCCGTATTGGCGGATCGATAAAACCGTCAAGAAGGGAC
AAAACCAGAGAAGGGAAAGATGAACTTGTTATGAAGATTTACCGCCCGAATGGTGCCCCCATTCAGACTGCAATG
GGTATCAGTTTGACGGTATATGATTTGATACCAACGCTGCTCAAAAGAATGGTTGGAGATGAAAGGCGTTTGAAT
CGGTTGTTTCTAATGGAACGTGGAAAGGGTGAGTTGAAAATATCTCTACCCACACTGTTGAGTAACGTTTGTCAT
GAACAGAGCGCATCATGGATATCAGAGAATTACCCCTCAATCTTATTTGTCGTCGAATGACGGAAGCTGGATATT
CATGGAACGATGGTCGGATTCTTCTCAGCGGCGATCGTCTAGCCTTTCTTCTCAAATTCATCTTCCGAGATCCAG
ACATGGGACTCGGTCGTCGATCACTCACCGCCGACGCCCCATACCAAATCCCCGAAAGCGAACTTCGACTACACA
ATTTTGAAACTCTCGATCTGTCAGGTCGAAGTCTACGTACTATCCCCGTCGCCCTACATCAACACGCTGATCAAA
TCATTTCATTGAAACTTTCCCGAAATCCGATGATTGATTTACCTTTGGATTTTGTAGAGGCTTGTACGTCGTTAT
GTGACTTGCGGCTGTCCAATATGTCGATGCGGAAGATTCCTGCAAATTTGGTTGCGGCTAAGGCGTTGAAGAGAC
TGGACCTTTCGTCGAACCATATCAAGATCAAAGAACTCGAGAATGCGAATTTGCAACTTATACCGGAGCTGAGGG
GGTTGCTGTTGCATAACAACCTGCTCAAGGATCTACCGCAGAAGTTTGCTGATTTCGAAAATCTACTGAATCTCA
ATATCTCGAGTAATCGGTTACCGACGATACCGGATGTTGTGTTACAGATCAAGACACTCACCGAGCTCGATGTTT
CCTTCAATTACATCACTGACCTTCCAACCAATGTTGGTGATATGACGAGTTTGCAACGGTTTTTGTTCGTCGGCA
ACTCCATCAAAAGTATTCCTAATAGCTTTTGGAAACTACGCAATCTGGAGCATGTTGATTGTCGAAGAAATCAAA
TTGGGGATTTGGGTATCGTGATGAATTTGCCTCGGCTCGAGACATTGAACGCCGATCATAATGCCATTCACCTAC
TCGACCTCTCTATGGGAAAACATGTCATGAAAATTGATCTGTCGAATAACGAGATTACGAAAGTCATGGTTTCGT
TACCGCCTTTTGGTTCGACATCACTTCAACTTACGACCTTGGACGTTTCGTATGCGAGTTTGACGACATTGGATG
GGGCGGTTTTGCGTAACCTTCCGACATTGGTCACTCTTCGAATTCAACACAATTCCCTTGCCTATCTACCTGATT
CTATCGAAGAACTCGTTCACCTGGAAACCTTCATCTGTTATGAAAATCGATTACAACGACTTCCGGATACCATTG
GCAAACTTTCAAAATTGATTACCTTGGATGCGCATAGCAATAACCTTCGTGAAGTTCCTGTTGCAATCTGGCAAT
GCCCTTCGCTGTGTATACTTAATCTTTCATCAAACTTTCTAACGACTTTTCCTGTACCGCCATTAATTCCTTTAT
ACCCCATGCCGGATCAAACAGGTCGTATAGCTGACCCGCCAAAAAATTATGATGCTTCGCACGTCATTTCAAGTA
TCCTCCATCCGCCACTCATGTTCTCCCTCGAAAATCTCTCTATATCCGAAAACAAAATTTCGTCAATCGACAGTC
TACGCAATATCTCATTTTTCCGTTCCCTGCTCTCATTAAACCTCTCTTACAATGATATCAGCGATTTGCCCAAAG
GGTTCTTTCGAAAGATGTATAGGTTGGAGGAGTTTCATATTTGTGGGAACGATTTGACTATGATTCCTGGTCATG
AGGAATTTAGCAATTTGAGGGAGTTGAGGAGGTTGTTTTTGAGTGGGAATAAATTGACGAGTTTGCCGGCGGAGT
TGGGGAGGTTGAAGAGGTTGAAGGTGATGGATGTGAGCAATAATTGTTTGAGGTATAATATTAATAATTATGGAT
ATGATTGGAATTGGTGAGTTCTCGGTTCGCCTGGTCTTTGAATTATTTTTTTTCTGAAGAGGTTTTTTTTTGGTT
TGTAGGAACAATAACGAGGACCTTTATTATCTCAATTTATCGGGAAACAAGCGGTTCCAGGTGAAACGTGACAAT
CGACATACGTTTGGATCTTCGAGGAGCAGTCGTGAACTCCATAACCCTCTTTCTGGATTTTCGAGTGTGCCCAAG
TTACGGATTCTGGGATTGATGGACGTTACGGTCACCGCTAGTGATCTTCCAGATGAACATGAGGATCGTCGAGTT
CGTTCCACGTCTTCTCTCGTTGGGGGTCTTGGATACGGTATCGCCGACAGTCTGAATATAGATGACTCGATGACA
ATGCTCGACCTCGTACATGAATTTCCTCCTATCAATGGTACCAGTCGTGCCTTGTTCGCCATGTTTGGTAATGCC
AAACCGCCGAAACTCCCAATAGGCGTCTCACCCAACAAGCATGCGAAATTCCTCCACGATCATTTTATTCCCTTT
TTTCAAAACCAATTGGATCATCCGTATTTGCAAGAAAGTAATCATTTTGCGGTGGATGTTTTGAGGAGATCATTT
TTGGGGTTGCATCAGACGATACATGATATGTGGTTTCCACCGGTTCAGAGGAAAGCGTCTATGGCGAGTGTGGCT
GGTGGTTTACCGACTGTGAATGTCGATTCTGGGACTGCTAGGACGGGTTGTTCGGGTTTGGTGGTTTATATTGAG
GGGAACAGATTGTTTGCGGCGAATGTGGGTTCGGCACATGGTGTTATTTCGAGGAAGGGTCAACCGTTTTTGGTT
ACAAGGATTCATTGTCCTTGGGATGAAGATGAATTGAAGAGGATGAGGAAGTCGGAAGGTTGGGTGTCACCTGAA
GGATTGGTGAATAATGAAGTTGACGTTTCGAGGTCGTTTGGCTATTATCAACTTTTACCCGTCGTCAATGCTTCT
CCTGACATCGTGGAATACGAGATTTCGGAGACGGATGAGTATTTGGTTTTGGGGAATAGGGCTTTGTGGGACTTT
GTGAGCTACCAGACGGCGGTGGATATCGCTAGTGGGAGAGGTGAACCTTCGATGATTGCGCAGAAGTTGAGAGAT
TTTGCGATAAGCTATGGATCGACGGGCAATATTATGGTGATGGTGGTGAGGCTGAAGGATTATCATGAAAGGCCC
CTCGTTCGGACACCGTCGATGATTGAATCGGATTCACCCTTCTCTCCGGCCTTGTATATCCCCAAATCGAATCAT
ATGGTGGTGGACAAGAGTGTACGACGAGCCGAACCAGAAGTCCCTCCACCAACAGGTCATATCGCGTTGGTATTC
ACTGACATCCGGAATTCAACTCATTTATGGGAAGTGAACCCCGGTATGCCAGCGGCCATTCAAATCCACAATGAT
TTGATGAGGAGACGATTGAGGGAATGTGGTGGGTACGAATTCAAAACAGAAGGAGACGCCTTTTTGTGCAGTTTT
CCGACTATCATGGCTGCTGTGTGGTTCTGTCTTTCGGTGCAGAATCAATTATTACAGGAGAACTGGCCAAAGGAG
ATTTTAGAATGCGAGGATGGGAAGGCTATCGTGGATTCGGAGGGGAATATGCTTTGGAAAGGTATCTCGGTCAGG
ATGGGTATCCATAGTGGGACGCCAGTGTGTTTGCAGGATCCTGTGACGCATAGGATGGATTATTATGGTCCGGTT
ATTAATCGAGCGGCGAGGGTTAGTGCATTGGCGAAGGGAGGACAGATTTTTTGTAGTGCGGAGGTGGTACAAGAG
ATCAAGGCATCGGTTTTGGAGGCTATAGAAAAGACGTCTCTGTCGAAATCACAACCTGCAAAAGCGATCGCGGAA
GTCAAGCAATTGGGGGTCATTATCAAGGAGGTCGGAGAGATGAAACTCAAGGGTTTGGAGGTACCTGAATTTATT
TCAGCGATTTATACCCCGGGACTGGAGGGCAGACATGATTTCGACGCGGAGGAAGATCCTGCACCTGCGAGCGTA
TACTTGGATGTTGCTCATGTACGCGAGATAGGTATGTTGTGTCTTCGACTGGAGGCGTTGACATCTGGACGGATA
TTCAAACCTTCAAATACCGCGAGGGACCTGAATTTGACCATTCCTCTCGAGGATGATCCTGAAGACGAAGACAAC
CCTGAGCTATGGAGAGATCTGGAGGTGGATCCTGAAAACCTGTTACCTCCGATGACGACGAGATGGACTGATCAT
GACCTCCTCACGACGCTGGACTCATTTACTTGTCGAATTCAGAACGCCCTTCAGACGCTTATCAAGGCATACGAA
GCGGATCGAATTAATGCACCGAATATCATGAATGTTCTCAGTAATGCTGGACTCGATGCTGATACGTTACTGGTC
ATGGCAGAACTTATTGGACATTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail