Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|038930
Gene name
Locationscaffold_02:103982..105560
Strand-
Gene length (bp)1578
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup113
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038890
Agaricus bisporus var bisporus H39 AgabiH39|038930
Agaricus bisporus var bisporus H39 AgabiH39|238500
Agaricus bisporus var bisporus H97 AgabiH97|038890
Agaricus bisporus var bisporus H97 AgabiH97|038900
Agaricus bisporus var bisporus H97 AgabiH97|038910
Agaricus bisporus var bisporus H97 AgabiH97|038920
Agaricus bisporus var bisporus H97 AgabiH97|038930
Agaricus bisporus var burnettii H119p4 Agabi119p4|038890
Agaricus bisporus var burnettii H119p4 Agabi119p4|038930 (this protein)
Agaricus bisporus var burnettii H119p4 Agabi119p4|574600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|038930
MEPSKIGLSSLPSEIVTEMFKQLDWRDLLNARQTCTLLYDASKSREIWDNLIRIHAVATYGVPTIFDKPMRTYNA
TNLEERFLHWMKTESTWLNEIPLNEKYIPDYSHEFLYSHFFPGGRWLICSDFGGEVLYCDLESPETGFVPLIPYP
FSCQRKSMTMMAVEEISGTETLPFKIALVHMLFADYVKGPHGQPEMTGDSRVDVWSGRVILDEDGQGKGLQVEQL
ASVPISLYLGQPLFGVSLRGPLVAFTVEWHLFGTTIYSCDAIIIDWSSWKSQGRSFNRKIVNYLPSYAGCGRKVE
VTLLPGNRVLTTPSPELCIYDHSLIPWSSKERPVWVDMSIPEQHSCCVTVPGSSVQHPCGFSRIFPLPKNEYRVV
FNTLEGVRGLILRYTESSGFKASALELLDWDEKVDCSIAEFRSHLSYNCGVARFKSGCLLRARFSWPEEEGFFET
GTSPILGETNETPLVMNMDVAAGRLAWIAVESGRVAMLDI*
Coding >Agabi119p4|038930
ATGGAACCGTCAAAGATTGGGCTCAGCTCGCTACCATCTGAAATCGTCACGGAAATGTTCAAACAGCTAGATTGG
AGAGATCTACTGAATGCACGCCAGACTTGTACACTCCTTTATGACGCGTCAAAATCCAGAGAGATATGGGACAAT
CTGATTAGAATCCATGCCGTCGCCACGTATGGGGTTCCGACGATATTTGACAAACCTATGCGAACTTATAATGCA
ACCAATCTCGAAGAGCGGTTTCTCCATTGGATGAAAACCGAATCCACCTGGCTCAATGAAATCCCTTTGAATGAA
AAATACATCCCGGATTATTCACACGAATTCCTGTACTCTCATTTTTTTCCAGGAGGCCGATGGCTCATCTGCTCC
GACTTTGGAGGCGAGGTGCTCTACTGCGATCTCGAATCACCCGAGACTGGCTTCGTTCCTCTGATCCCGTATCCG
TTCTCGTGCCAGCGCAAATCTATGACTATGATGGCTGTCGAAGAAATTTCCGGGACTGAGACCTTACCTTTTAAA
ATCGCCCTGGTCCATATGTTGTTTGCCGACTATGTGAAAGGGCCACATGGTCAACCTGAGATGACTGGAGATTCG
CGGGTTGATGTGTGGTCAGGTCGCGTTATCTTAGACGAGGACGGCCAGGGAAAGGGTTTGCAAGTTGAGCAACTC
GCATCTGTGCCTATATCTTTGTATCTTGGCCAACCTTTATTCGGTGTATCTTTACGTGGTCCACTTGTTGCCTTC
ACCGTAGAATGGCATTTGTTCGGCACGACAATTTACTCATGTGATGCGATTATCATAGACTGGAGCTCATGGAAG
AGTCAGGGTCGATCCTTTAATCGGAAAATTGTCAATTATCTACCCAGTTACGCTGGTTGTGGTCGGAAGGTCGAA
GTAACGTTACTCCCTGGAAACCGAGTGCTCACCACGCCATCTCCAGAGCTTTGCATTTACGACCATTCATTGATC
CCATGGTCCTCGAAGGAGAGACCTGTGTGGGTCGATATGTCTATACCTGAACAACATTCATGTTGCGTCACCGTC
CCCGGAAGCTCCGTCCAACATCCTTGCGGTTTCTCCAGGATATTTCCTCTCCCAAAAAATGAGTATCGAGTGGTA
TTCAATACGTTAGAGGGGGTAAGGGGACTCATCCTGCGTTATACGGAAAGCAGCGGATTCAAGGCATCGGCGTTG
GAGCTCCTCGACTGGGATGAAAAAGTGGATTGTTCTATCGCTGAATTCCGATCACATCTCTCGTACAATTGTGGC
GTCGCCCGCTTTAAGTCAGGATGCCTTTTACGTGCTCGTTTTTCCTGGCCTGAAGAGGAAGGCTTCTTCGAAACG
GGGACGTCTCCTATTTTAGGCGAGACGAATGAGACACCCCTGGTTATGAACATGGATGTTGCAGCTGGAAGGCTG
GCATGGATAGCAGTAGAGAGTGGTCGAGTGGCTATGCTGGATATTTAG
Transcript >Agabi119p4|038930
ATGGAACCGTCAAAGATTGGGCTCAGCTCGCTACCATCTGAAATCGTCACGGAAATGTTCAAACAGCTAGATTGG
AGAGATCTACTGAATGCACGCCAGACTTGTACACTCCTTTATGACGCGTCAAAATCCAGAGAGATATGGGACAAT
CTGATTAGAATCCATGCCGTCGCCACGTATGGGGTTCCGACGATATTTGACAAACCTATGCGAACTTATAATGCA
ACCAATCTCGAAGAGCGGTTTCTCCATTGGATGAAAACCGAATCCACCTGGCTCAATGAAATCCCTTTGAATGAA
AAATACATCCCGGATTATTCACACGAATTCCTGTACTCTCATTTTTTTCCAGGAGGCCGATGGCTCATCTGCTCC
GACTTTGGAGGCGAGGTGCTCTACTGCGATCTCGAATCACCCGAGACTGGCTTCGTTCCTCTGATCCCGTATCCG
TTCTCGTGCCAGCGCAAATCTATGACTATGATGGCTGTCGAAGAAATTTCCGGGACTGAGACCTTACCTTTTAAA
ATCGCCCTGGTCCATATGTTGTTTGCCGACTATGTGAAAGGGCCACATGGTCAACCTGAGATGACTGGAGATTCG
CGGGTTGATGTGTGGTCAGGTCGCGTTATCTTAGACGAGGACGGCCAGGGAAAGGGTTTGCAAGTTGAGCAACTC
GCATCTGTGCCTATATCTTTGTATCTTGGCCAACCTTTATTCGGTGTATCTTTACGTGGTCCACTTGTTGCCTTC
ACCGTAGAATGGCATTTGTTCGGCACGACAATTTACTCATGTGATGCGATTATCATAGACTGGAGCTCATGGAAG
AGTCAGGGTCGATCCTTTAATCGGAAAATTGTCAATTATCTACCCAGTTACGCTGGTTGTGGTCGGAAGGTCGAA
GTAACGTTACTCCCTGGAAACCGAGTGCTCACCACGCCATCTCCAGAGCTTTGCATTTACGACCATTCATTGATC
CCATGGTCCTCGAAGGAGAGACCTGTGTGGGTCGATATGTCTATACCTGAACAACATTCATGTTGCGTCACCGTC
CCCGGAAGCTCCGTCCAACATCCTTGCGGTTTCTCCAGGATATTTCCTCTCCCAAAAAATGAGTATCGAGTGGTA
TTCAATACGTTAGAGGGGGTAAGGGGACTCATCCTGCGTTATACGGAAAGCAGCGGATTCAAGGCATCGGCGTTG
GAGCTCCTCGACTGGGATGAAAAAGTGGATTGTTCTATCGCTGAATTCCGATCACATCTCTCGTACAATTGTGGC
GTCGCCCGCTTTAAGTCAGGATGCCTTTTACGTGCTCGTTTTTCCTGGCCTGAAGAGGAAGGCTTCTTCGAAACG
GGGACGTCTCCTATTTTAGGCGAGACGAATGAGACACCCCTGGTTATGAACATGGATGTTGCAGCTGGAAGGCTG
GCATGGATAGCAGTAGAGAGTGGTCGAGTGGCTATGCTGGATATTTAG
Gene >Agabi119p4|038930
ATGGAACCGTCAAAGATTGGGCTCAGCTCGCTACCATCTGAAATCGTCACGGAAATGTTCAAACAGCTAGATTGG
AGAGATCTACTGAATGCACGCCAGGTGGGTGCATCATGTATAAGCTCTCTATATCGCAATGTAATCTGTAATTTG
TAGACTTGTACACTCCTTTATGACGCGTCAAAATCCAGAGAGATATGGGACAATCTGATTAGAATCCATGCCGTC
GCCACGTATGGGGTTCCGACGATATTTGACAAACCTATGCGAACTTATAATGCAACCAATCTCGAAGAGCGGTTT
CTCCATTGGATGAAAACCGAATCCACCTGGCTCAATGAAATCCCTTTGAATGAAAAATACATCCCGGATTATTCA
CACGAATTCCTGTACTCTCATTTTTTTCCAGGAGGCCGATGGCTCATCTGCTCCGACTTTGGAGGCGAGGTGCTC
TACTGCGATCTCGAATCACCCGAGACTGGCTTCGTTCCTCTGATCCCGTATCCGTTCTCGTGCCAGCGCAAATCT
ATGACTATGATGGCTGTCGAAGAAATTTCCGGGACTGAGACCTTACCTTTTAAAATCGCCCTGGTCCATATGTTG
TTTGCCGACTATGTGAAAGGGCCACATGGTCAACCTGAGATGACTGGAGATTCGCGGGTTGATGTGTGGTCAGGT
CGCGTTATCTTAGACGAGGACGGCCAGGGAAAGGGTTTGCAAGTTGAGCAACTCGCATCTGTGCCTATATCTTTG
TATCTTGGCCAACCTTTATTCGGTGTATCTTTACGTGGTCCACTTGTTGCCTTCACCGTAGAATGGCATTTGTTC
GGCACGACAATTTACTCATGTGATGCGATTATCATAGACTGGAGCTCATGGAAGAGTCAGGGTCGATCCTTTAAT
CGGAAAATTGTCAATTATCTACCCAGTTACGCTGGTTGTGGTCGGAAGGTGAGTTGAGCTCTCATTTAAAACCAC
ACTATTACGCAATATCTATTCCAGGTCGAAGTAACGTTACTCCCTGGAAACCGAGTGCTCACCACGCCATCTCCA
GAGCTTTGCATTTACGACCATTCATTGATCCCATGGTCCTCGAAGGAGAGACCTGTGTGGGTCGATATGTCTATA
CCTGAACAACATTCATGTTGCGTCACCGTCCCCGGAAGCTCCGTCCAACATCCTTGCGGTTTCTCCAGGATATTT
CCTCTCCCAAAAAATGAGTATCGAGTGGTATTCAATACGTTAGAGGGGGTAAGGGGACTCATCCTGCGTTATACG
GAAAGCAGCGGATTCAAGGCATCGGCGTTGGAGCTCCTCGACTGGGATGAAAAAGTGGATTGTTCTATCGCTGAA
TTCCGATCACATCTCTCGTACAATTGTGGCGTCGCCCGCTTTAAGTCAGGATGCCTTTTACGTGCTCGTTTTTCC
TGGCCTGAAGAGGAAGGCTTCTTCGAAACGGGGACGTCTCCTATTTTAGGCGAGACGAATGAGACACCCCTGGTT
ATGAACATGGATGTTGCAGCTGGAAGGCTGGCATGGATAGCAGTAGAGAGTGGTCGAGTGGCTATGCTGGATATT
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail