Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|038850
Gene name
Locationscaffold_02:86270..87930
Strand+
Gene length (bp)1660
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup208
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038860
Agaricus bisporus var bisporus H39 AgabiH39|038870
Agaricus bisporus var bisporus H97 AgabiH97|038850
Agaricus bisporus var bisporus H97 AgabiH97|038860
Agaricus bisporus var bisporus H97 AgabiH97|038870
Agaricus bisporus var burnettii H119p4 Agabi119p4|038850 (this protein)
Agaricus bisporus var burnettii H119p4 Agabi119p4|038860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|038850
MLMTCQTAEGSKTGFSLLPPELVVEVFKRLHWRDLLKARSTCSVFYSISKSRDIWENLIRIHAAAMHGPPTTLEK
PMRMYTAGKLEEHFLRGAKNESEWLDEVRFEERSIPSPHRLRHCHLLRGGRWFLCSAVGGEMLYCDLESPGSGLV
PLIPYPFPHPCDSITSMAIEEDNEAEILCFKIALVHILEEDWLYRSSGETAVTGDSRADVWFGKVVLDEDGNATH
LHAEKLASVPLPVYLGKPILGASLRGSLVAFTVEWKSLDGFGMQCDAIILDWKAPPRTKNQPCIRKTVHYSITWA
QPAVKTDVILLPGDHLLTVVQSMIRIYDHSLVPWASERRHKREVLSLSEQCAHAINIPKSFCGVPRDFSPIFSLS
GDRYRVVFNSLSGIRGLTLQYRDGGVFKATLVDLLEWPKAMDVFIEDRQSHFSYNYGVTLGSYDSLFRSHFTWPD
EEGSSPSRLSVMVGNLSRLPVVMNMDVSTGRVLWISKHGELKEASFTAPS*
Coding >Agabi119p4|038850
ATGTTAATGACTTGCCAAACAGCTGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAA
GTATTCAAACGATTACATTGGAGAGACCTACTGAAGGCGCGCTCAACTTGCTCAGTCTTTTACAGTATCTCTAAG
TCTAGGGATATATGGGAGAACTTGATTCGAATTCACGCTGCTGCCATGCATGGGCCCCCGACAACGTTGGAAAAA
CCTATGCGTATGTATACCGCTGGAAAACTCGAAGAGCATTTCCTTCGTGGTGCGAAAAATGAGTCCGAGTGGCTG
GACGAGGTTCGGTTTGAAGAACGGAGTATTCCGTCTCCTCACAGGTTGAGGCATTGTCATCTCCTCCGAGGCGGA
CGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGATGCTCTATTGTGACCTCGAATCGCCTGGATCTGGATTAGTT
CCCTTGATCCCATATCCATTCCCACACCCATGCGACTCTATCACTTCAATGGCTATCGAAGAAGACAACGAGGCG
GAAATTCTATGTTTTAAAATCGCTCTAGTCCATATTTTGGAGGAAGATTGGTTATATAGATCGAGTGGCGAAACG
GCTGTGACTGGAGACTCCCGGGCTGACGTGTGGTTTGGAAAGGTCGTTTTGGATGAAGATGGGAATGCTACGCAT
TTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTATCTTGGTAAACCAATATTGGGTGCATCTTTGCGC
GGCTCACTGGTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGATTTGGCATGCAATGCGACGCGATCATTTTA
GACTGGAAAGCGCCGCCAAGGACTAAAAATCAGCCATGTATCCGTAAGACTGTCCATTATTCTATCACCTGGGCT
CAACCTGCCGTCAAGACGGATGTAATACTCCTCCCCGGAGATCACTTGCTTACCGTAGTTCAATCGATGATTCGC
ATTTATGACCACTCCTTGGTTCCGTGGGCCTCAGAGCGACGGCACAAGCGTGAGGTACTTTCGCTTTCTGAGCAA
TGTGCACACGCTATCAATATACCCAAATCCTTTTGCGGCGTTCCTCGCGATTTCTCGCCTATATTTTCCCTCTCT
GGAGATCGATATCGCGTGGTGTTCAATAGCTTGAGTGGGATAAGGGGTTTGACGTTGCAATACAGAGACGGGGGT
GTATTCAAAGCCACTTTGGTTGACCTTTTGGAGTGGCCCAAAGCGATGGATGTATTCATCGAGGATCGCCAGTCC
CACTTCTCATATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTCCGTTCTCATTTTACTTGGCCAGAT
GAGGAGGGATCATCACCAAGCAGGCTCTCAGTCATGGTCGGAAACCTGAGTCGGCTTCCTGTTGTCATGAACATG
GATGTTAGTACAGGGAGAGTGTTATGGATATCGAAACACGGTGAACTGAAAGAGGCTTCGTTCACAGCGCCGTCG
TAA
Transcript >Agabi119p4|038850
ATGTTAATGACTTGCCAAACAGCTGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAA
GTATTCAAACGATTACATTGGAGAGACCTACTGAAGGCGCGCTCAACTTGCTCAGTCTTTTACAGTATCTCTAAG
TCTAGGGATATATGGGAGAACTTGATTCGAATTCACGCTGCTGCCATGCATGGGCCCCCGACAACGTTGGAAAAA
CCTATGCGTATGTATACCGCTGGAAAACTCGAAGAGCATTTCCTTCGTGGTGCGAAAAATGAGTCCGAGTGGCTG
GACGAGGTTCGGTTTGAAGAACGGAGTATTCCGTCTCCTCACAGGTTGAGGCATTGTCATCTCCTCCGAGGCGGA
CGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGATGCTCTATTGTGACCTCGAATCGCCTGGATCTGGATTAGTT
CCCTTGATCCCATATCCATTCCCACACCCATGCGACTCTATCACTTCAATGGCTATCGAAGAAGACAACGAGGCG
GAAATTCTATGTTTTAAAATCGCTCTAGTCCATATTTTGGAGGAAGATTGGTTATATAGATCGAGTGGCGAAACG
GCTGTGACTGGAGACTCCCGGGCTGACGTGTGGTTTGGAAAGGTCGTTTTGGATGAAGATGGGAATGCTACGCAT
TTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTATCTTGGTAAACCAATATTGGGTGCATCTTTGCGC
GGCTCACTGGTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGATTTGGCATGCAATGCGACGCGATCATTTTA
GACTGGAAAGCGCCGCCAAGGACTAAAAATCAGCCATGTATCCGTAAGACTGTCCATTATTCTATCACCTGGGCT
CAACCTGCCGTCAAGACGGATGTAATACTCCTCCCCGGAGATCACTTGCTTACCGTAGTTCAATCGATGATTCGC
ATTTATGACCACTCCTTGGTTCCGTGGGCCTCAGAGCGACGGCACAAGCGTGAGGTACTTTCGCTTTCTGAGCAA
TGTGCACACGCTATCAATATACCCAAATCCTTTTGCGGCGTTCCTCGCGATTTCTCGCCTATATTTTCCCTCTCT
GGAGATCGATATCGCGTGGTGTTCAATAGCTTGAGTGGGATAAGGGGTTTGACGTTGCAATACAGAGACGGGGGT
GTATTCAAAGCCACTTTGGTTGACCTTTTGGAGTGGCCCAAAGCGATGGATGTATTCATCGAGGATCGCCAGTCC
CACTTCTCATATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTCCGTTCTCATTTTACTTGGCCAGAT
GAGGAGGGATCATCACCAAGCAGGCTCTCAGTCATGGTCGGAAACCTGAGTCGGCTTCCTGTTGTCATGAACATG
GATGTTAGTACAGGGAGAGTGTTATGGATATCGAAACACGGTGAACTGAAAGAGGCTTCGTTCACAGCGCCGTCG
TAA
Gene >Agabi119p4|038850
ATGTTAATGACTTGCCAAACAGCTGTGAGTCTTCGCGTAAAACAAACTCTTGTGTCCTTCTTCACAAATCTACCA
GGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAAGTATTCAAACGATTACATTGGAG
AGACCTACTGAAGGCGCGCTCAGTGAGTCTCAAACTCCGGTGTACGATTCTATATATACGATTCTTATCCTGTAG
ACTTGCTCAGTCTTTTACAGTATCTCTAAGTCTAGGGATATATGGGAGAACTTGATTCGAATTCACGCTGCTGCC
ATGCATGGGCCCCCGACAACGTTGGAAAAACCTATGCGTATGTATACCGCTGGAAAACTCGAAGAGCATTTCCTT
CGTGGTGCGAAAAATGAGTCCGAGTGGCTGGACGAGGTTCGGTTTGAAGAACGGAGTATTCCGTCTCCTCACAGG
TTGAGGCATTGTCATCTCCTCCGAGGCGGACGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGATGCTCTATTGT
GACCTCGAATCGCCTGGATCTGGATTAGTTCCCTTGATCCCATATCCATTCCCACACCCATGCGACTCTATCACT
TCAATGGCTATCGAAGAAGACAACGAGGCGGAAATTCTATGTTTTAAAATCGCTCTAGTCCATATTTTGGAGGAA
GATTGGTTATATAGATCGAGTGGCGAAACGGCTGTGACTGGAGACTCCCGGGCTGACGTGTGGTTTGGAAAGGTC
GTTTTGGATGAAGATGGGAATGCTACGCATTTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTATCTT
GGTAAACCAATATTGGGTGCATCTTTGCGCGGCTCACTGGTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGA
TTTGGCATGCAATGCGACGCGATCATTTTAGACTGGAAAGCGCCGCCAAGGACTAAAAATCAGCCATGTATCCGT
AAGACTGTCCATTATTCTATCACCTGGGCTCAACCTGCCGTCAAGGTGAGCTCGTTCATTTGATTTGTGAAGTAC
CAATCAAACACAGTTCTGTTAGACGGATGTAATACTCCTCCCCGGAGATCACTTGCTTACCGTAGTTCAATCGAT
GATTCGCATTTATGACCACTCCTTGGTTCCGTGGGCCTCAGAGCGACGGCACAAGCGTGAGGTACTTTCGCTTTC
TGAGCAATGTGCACACGCTATCAATATACCCAAATCCTTTTGCGGCGTTCCTCGCGATTTCTCGCCTATATTTTC
CCTCTCTGGAGATCGATATCGCGTGGTGTTCAATAGCTTGAGTGGGATAAGGGGTTTGACGTTGCAATACAGAGA
CGGGGGTGTATTCAAAGCCACTTTGGTTGACCTTTTGGAGTGGCCCAAAGCGATGGATGTATTCATCGAGGATCG
CCAGTCCCACTTCTCATATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTCCGTTCTCATTTTACTTG
GCCAGATGAGGAGGGATCATCACCAAGCAGGCTCTCAGTCATGGTCGGAAACCTGAGTCGGCTTCCTGTTGTCAT
GAACATGGATGTTAGTACAGGGAGAGTGTTATGGATATCGAAACACGGTGAACTGAAAGAGGCTTCGTTCACAGC
GCCGTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail