Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|038550
Gene name
Locationscaffold_13:1310467..1311505
Strand-
Gene length (bp)1038
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.3E-36 51 244
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.8E-13 57 253
PF08659 KR KR domain 1.3E-06 53 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 52 257 6.0E-14
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 52 257 7.0E-14
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 51 239 7.0E-14
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 52 257 9.0E-14
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 52 257 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 52 257 6.0E-14
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 52 257 7.0E-14
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 51 239 7.0E-14
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 52 257 9.0E-14
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 52 257 1.0E-13
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 6 299 4.0E-13
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 6 299 4.0E-13
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 52 260 5.0E-13
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 52 260 5.0E-13
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 48 256 2.0E-12
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 40 239 2.0E-11
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 51 239 5.0E-11
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 51 239 5.0E-11
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 47 240 6.0E-11
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 47 240 6.0E-11
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 51 239 1.0E-10
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 51 239 1.0E-10
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 51 239 1.0E-10
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 43 268 4.0E-10
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 43 268 4.0E-10
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 51 239 4.0E-10
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 51 239 5.0E-10
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 51 239 5.0E-10
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 43 245 7.0E-10
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 50 270 8.0E-10
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 27 259 9.0E-10
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 47 265 9.0E-10
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 51 253 9.0E-10
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 47 265 1.0E-09
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 36 240 1.0E-09
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 47 242 2.0E-09
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 40 239 3.0E-09
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 51 247 3.0E-09
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 15 244 4.0E-09
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 50 270 6.0E-09
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 48 280 9.0E-09
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 48 280 9.0E-09
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 48 256 9.0E-09
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 54 244 1.0E-08
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 47 245 1.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 47 239 1.0E-08
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 49 264 2.0E-08
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 49 264 2.0E-08
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 51 276 2.0E-08
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 53 239 3.0E-08
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 52 241 4.0E-08
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 51 245 4.0E-08
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 43 280 4.0E-08
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 51 239 6.0E-08
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 51 239 6.0E-08
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 49 264 9.0E-08
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 49 264 9.0E-08
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 43 231 1.0E-07
sp|P9WGS9|DPRE2_MYCTU NAD-dependent decaprenylphosphoryl-D-2-keto erythropentose reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dprE2 PE=1 SV=1 50 249 1.0E-07
sp|P9WGS8|DPRE2_MYCTO NAD-dependent decaprenylphosphoryl-D-2-keto erythropentose reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dprE2 PE=3 SV=1 50 249 1.0E-07
sp|P66784|DPRE2_MYCBO NAD-dependent decaprenylphosphoryl-D-2-keto erythropentose reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dprE2 PE=3 SV=1 50 249 1.0E-07
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 32 261 1.0E-07
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 47 264 1.0E-07
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 51 244 1.0E-07
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 47 236 1.0E-07
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 43 245 2.0E-07
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 43 245 2.0E-07
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 12 250 2.0E-07
sp|B0XSI3|MKAR_ASPFC Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1 12 250 2.0E-07
sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 30 250 2.0E-07
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 17 278 2.0E-07
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 45 239 2.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 51 239 2.0E-07
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 108 239 3.0E-07
sp|Q56632|VIBA_VIBCH Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibA PE=3 SV=1 53 245 4.0E-07
sp|P9WGQ3|Y1714_MYCTU Uncharacterized oxidoreductase Rv1714 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1714 PE=3 SV=1 48 242 5.0E-07
sp|P9WGQ2|Y1714_MYCTO Uncharacterized oxidoreductase MT1753.1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1753.1 PE=3 SV=1 48 242 5.0E-07
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 30 250 5.0E-07
sp|A0R610|DPRE2_MYCS2 NAD-dependent decaprenylphosphoryl-D-2-keto erythropentose reductase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE2 PE=1 SV=1 50 244 6.0E-07
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 48 239 6.0E-07
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 51 245 7.0E-07
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 48 239 7.0E-07
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 51 245 7.0E-07
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 51 245 7.0E-07
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 51 245 7.0E-07
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 51 245 7.0E-07
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 51 245 7.0E-07
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 51 245 7.0E-07
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 27 273 7.0E-07
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 44 231 8.0E-07
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 48 269 9.0E-07
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 53 248 1.0E-06
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 53 239 1.0E-06
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 51 245 2.0E-06
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 52 250 2.0E-06
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 51 247 2.0E-06
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 51 247 2.0E-06
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 51 247 2.0E-06
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 52 242 2.0E-06
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 48 238 3.0E-06
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 49 242 3.0E-06
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 52 242 3.0E-06
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 48 269 3.0E-06
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 51 302 3.0E-06
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 51 245 3.0E-06
sp|A1C6J8|MKAR_ASPCL Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_070510 PE=3 SV=1 16 251 3.0E-06
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 49 237 3.0E-06
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 49 242 3.0E-06
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 48 236 4.0E-06
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 52 236 4.0E-06
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 26 259 4.0E-06
sp|A6RBW9|MKAR_AJECN Very-long-chain 3-oxoacyl-CoA reductase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_07127 PE=3 SV=1 27 303 5.0E-06
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 46 242 5.0E-06
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 46 242 8.0E-06
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 54 244 8.0E-06
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 46 242 8.0E-06
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 38 268 8.0E-06
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 26 236 9.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 46 242 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|038550
MIPPTTHALHNITLSLATVLVALASLAFTTFIILPLSLFRPLLVSPQVKPKVVLVIGASSGIGLEVLKQYSTEPI
TLIAASSNLAKLKSAIESLGPTNASIHLKQVNLKDASKIIKKAIGDIDKTYGPLTHLYAVSGISNHLDPDSPWDL
RVTEAMISVNISGTVTAVLSAYELMKERSYGKICIVGSLAGYYSPANMISYASTKAFINTFAINLRSLAAPYGVD
VITVAPGLIQSRMTDQMRSQGSTVPAFEYESTSGMASAMVHAVETGGIPLVAWPWRQSLTFYSFQALNPICDSLG
RFIAFKARLTGKKIT*
Coding >Agabi119p4|038550
ATGATCCCTCCCACCACACACGCTCTGCATAATATCACCCTTTCTCTCGCTACGGTTCTCGTCGCCCTCGCCTCC
CTCGCTTTCACCACTTTTATCATTCTCCCCCTCTCTCTCTTCAGGCCATTGCTAGTCTCTCCCCAGGTTAAACCC
AAAGTCGTCCTCGTCATCGGTGCCTCTAGTGGAATCGGCCTCGAGGTCCTCAAACAGTACTCGACCGAGCCCATC
ACCCTCATCGCCGCCTCTAGCAACCTCGCCAAGCTCAAGTCTGCCATCGAGTCTCTCGGCCCCACCAATGCTTCC
ATTCACCTCAAACAGGTCAACCTCAAAGACGCGTCCAAGATCATCAAGAAGGCTATAGGCGACATTGACAAGACT
TATGGTCCCCTCACCCATCTCTACGCCGTCAGCGGAATATCCAACCACCTCGACCCCGACTCGCCCTGGGATCTC
CGAGTCACCGAAGCCATGATCAGCGTCAACATCTCTGGCACCGTCACTGCCGTCCTCTCCGCCTATGAACTCATG
AAGGAGCGCTCTTATGGAAAAATCTGCATCGTCGGTTCTCTCGCCGGTTACTATTCCCCCGCCAACATGATCTCC
TATGCCTCTACCAAAGCCTTCATCAACACCTTTGCTATCAATCTCCGCTCTTTGGCCGCTCCCTACGGTGTCGAC
GTCATCACTGTCGCTCCAGGTCTCATCCAGTCCCGCATGACTGATCAAATGCGCTCCCAAGGTAGTACTGTTCCC
GCCTTTGAATACGAGTCTACTTCAGGTATGGCTTCTGCCATGGTCCACGCCGTCGAAACCGGAGGCATCCCACTC
GTCGCTTGGCCTTGGCGTCAATCCCTCACTTTCTACTCCTTCCAAGCTTTGAATCCTATCTGTGATTCTCTTGGC
CGTTTTATAGCCTTCAAAGCACGTCTAACCGGCAAGAAGATCACCTAA
Transcript >Agabi119p4|038550
ATGATCCCTCCCACCACACACGCTCTGCATAATATCACCCTTTCTCTCGCTACGGTTCTCGTCGCCCTCGCCTCC
CTCGCTTTCACCACTTTTATCATTCTCCCCCTCTCTCTCTTCAGGCCATTGCTAGTCTCTCCCCAGGTTAAACCC
AAAGTCGTCCTCGTCATCGGTGCCTCTAGTGGAATCGGCCTCGAGGTCCTCAAACAGTACTCGACCGAGCCCATC
ACCCTCATCGCCGCCTCTAGCAACCTCGCCAAGCTCAAGTCTGCCATCGAGTCTCTCGGCCCCACCAATGCTTCC
ATTCACCTCAAACAGGTCAACCTCAAAGACGCGTCCAAGATCATCAAGAAGGCTATAGGCGACATTGACAAGACT
TATGGTCCCCTCACCCATCTCTACGCCGTCAGCGGAATATCCAACCACCTCGACCCCGACTCGCCCTGGGATCTC
CGAGTCACCGAAGCCATGATCAGCGTCAACATCTCTGGCACCGTCACTGCCGTCCTCTCCGCCTATGAACTCATG
AAGGAGCGCTCTTATGGAAAAATCTGCATCGTCGGTTCTCTCGCCGGTTACTATTCCCCCGCCAACATGATCTCC
TATGCCTCTACCAAAGCCTTCATCAACACCTTTGCTATCAATCTCCGCTCTTTGGCCGCTCCCTACGGTGTCGAC
GTCATCACTGTCGCTCCAGGTCTCATCCAGTCCCGCATGACTGATCAAATGCGCTCCCAAGGTAGTACTGTTCCC
GCCTTTGAATACGAGTCTACTTCAGGTATGGCTTCTGCCATGGTCCACGCCGTCGAAACCGGAGGCATCCCACTC
GTCGCTTGGCCTTGGCGTCAATCCCTCACTTTCTACTCCTTCCAAGCTTTGAATCCTATCTGTGATTCTCTTGGC
CGTTTTATAGCCTTCAAAGCACGTCTAACCGGCAAGAAGATCACCTAA
Gene >Agabi119p4|038550
ATGATCCCTCCCACCACACACGCTCTGCATAATATCACCCTTTCTCTCGCTACGGTTCTCGTCGCCCTCGCCTCC
CTCGCTTTCACCACTTTTATCATTCTCCCCCTCTCTCTCTTCAGGCCATTGCTAGTCTCTCCCCAGGTTAAACCC
AAAGTCGTCCTCGTCATCGGTGCCTCTAGTGGAATCGGCCTCGAGGTCCTCAAACAGTACTCGACCGAGCCCATC
ACCCTCATCGCCGCCTCTAGCAACCTCGCCAAGCTCAAGTCTGCCATCGAGTCTCTCGGCCCCACCAATGCTTCC
ATTCACCTCAAACAGGTCAACCTCAAAGACGCGTCCAAGATCATCAAGAAGGCTATAGGCGACATTGACAAGACT
TATGGTCCCCTCACCCATCTCTACGCCGTCAGCGGAATATCCAACCACCTCGACCCCGACTCGCCCTGGGATCTC
CGAGTCACCGAAGCCATGATCAGCGTCAACATCTCTGGCACCGTCACTGCCGTCCTCTCCGCCTATGAACTCATG
AAGGAGCGCTCTTATGGAAAAATCGTACGCCCATCTCATTTCCATGCGCATATACTCACTTTTTCCCAGTGCATC
GTCGGTTCTCTCGCCGGTTACTATTCCCCCGCCAACATGATCTCCTATGCCTCTACCAAAGCCTTCATCAACACC
TTTGCTATCAATCTCCGCTCTTTGGCCGCTCCCTACGGTGTCGACGTCATCACTGTCGCTCCAGGTCTCATCCAG
TCCCGCATGACTGATCAAATGCGCTCCCAAGGTAGTACTGTTCCCGCCTTTGAATACGAGTCTACTTCAGGTATG
GCTTCTGCCATGGTCCACGCCGTCGAAACCGGAGGCATCCCACTCGTCGCTTGGCCTTGGCGTCAATCCCTCACT
TTCTACTCCTTCCAAGGTAACTTTTTGCACTCGCTTACTTCCATTCATTCACCCCCTCTAGCTTTGAATCCTATC
TGTGATTCTCTTGGCCGTTTTATAGCCTTCAAAGCACGTCTAACCGGCAAGAAGATCACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail