Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|037870
Gene name
Locationscaffold_13:1141836..1144890
Strand-
Gene length (bp)3054
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 1.6E-12 430 661
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 1.1E-07 416 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q80Y81|RNZ2_MOUSE Zinc phosphodiesterase ELAC protein 2 OS=Mus musculus GN=Elac2 PE=1 SV=1 201 670 5.0E-47
sp|Q8CGS5|RNZ2_RAT Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus GN=Elac2 PE=1 SV=1 201 670 2.0E-46
sp|Q8HY87|RNZ2_MACFA Zinc phosphodiesterase ELAC protein 2 OS=Macaca fascicularis GN=ELAC2 PE=2 SV=1 201 703 2.0E-45
sp|Q9GL72|RNZ2_PANTR Zinc phosphodiesterase ELAC protein 2 OS=Pan troglodytes GN=ELAC2 PE=2 SV=1 201 670 5.0E-45
sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2 201 670 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q80Y81|RNZ2_MOUSE Zinc phosphodiesterase ELAC protein 2 OS=Mus musculus GN=Elac2 PE=1 SV=1 201 670 5.0E-47
sp|Q8CGS5|RNZ2_RAT Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus GN=Elac2 PE=1 SV=1 201 670 2.0E-46
sp|Q8HY87|RNZ2_MACFA Zinc phosphodiesterase ELAC protein 2 OS=Macaca fascicularis GN=ELAC2 PE=2 SV=1 201 703 2.0E-45
sp|Q9GL72|RNZ2_PANTR Zinc phosphodiesterase ELAC protein 2 OS=Pan troglodytes GN=ELAC2 PE=2 SV=1 201 670 5.0E-45
sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2 201 670 5.0E-45
sp|Q9GL73|RNZ2_GORGO Zinc phosphodiesterase ELAC protein 2 OS=Gorilla gorilla gorilla GN=ELAC2 PE=2 SV=1 201 670 1.0E-44
sp|Q8MKW7|RNZ_DROME Ribonuclease Z, mitochondrial OS=Drosophila melanogaster GN=JhI-1 PE=1 SV=2 1 703 3.0E-42
sp|Q10155|RNZ1_SCHPO Ribonuclease Z 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trz1 PE=3 SV=1 248 677 8.0E-38
sp|P36159|RNZ_YEAST Ribonuclease Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRZ1 PE=1 SV=1 208 702 4.0E-36
sp|P87168|RNZ2_SCHPO Ribonuclease Z 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trz2 PE=3 SV=1 248 662 3.0E-29
sp|O44476|RNZ_CAEEL Ribonuclease Z OS=Caenorhabditis elegans GN=hoe-1 PE=2 SV=2 401 701 5.0E-28
sp|O29323|RNZ_ARCFU Ribonuclease Z OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rnz PE=3 SV=1 401 700 4.0E-20
sp|O27859|RNZ_METTH Ribonuclease Z OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rnz PE=3 SV=1 401 703 2.0E-19
sp|Q65HN6|RNZ_BACLD Ribonuclease Z OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rnz PE=3 SV=1 401 662 4.0E-18
sp|Q03K89|RNZ_STRTD Ribonuclease Z OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rnz PE=3 SV=1 405 664 5.0E-18
sp|Q5M3Y3|RNZ_STRT2 Ribonuclease Z OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rnz PE=3 SV=1 405 664 5.0E-18
sp|Q5LZD1|RNZ_STRT1 Ribonuclease Z OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rnz PE=3 SV=1 405 664 5.0E-18
sp|A8ADW5|RBN_CITK8 Ribonuclease BN OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rbn PE=3 SV=1 401 662 6.0E-18
sp|Q3IRM5|RNZ_NATPD Ribonuclease Z OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rnz PE=3 SV=1 398 686 2.0E-17
sp|P54548|RNZ_BACSU Ribonuclease Z OS=Bacillus subtilis (strain 168) GN=rnz PE=1 SV=1 401 700 4.0E-17
sp|Q03QP5|RNZ_LACBA Ribonuclease Z OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rnz PE=3 SV=1 401 662 2.0E-16
sp|C0ZBP8|RNZ_BREBN Ribonuclease Z OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rnz PE=3 SV=1 402 664 3.0E-16
sp|B2VHF1|RBN_ERWT9 Ribonuclease BN OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rbn PE=3 SV=1 405 662 9.0E-16
sp|Q3AHP8|RNZ_SYNSC Ribonuclease Z OS=Synechococcus sp. (strain CC9605) GN=rnz PE=3 SV=1 401 700 1.0E-15
sp|Q8TLK5|RNZ_METAC Ribonuclease Z OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rnz PE=3 SV=1 401 700 1.0E-15
sp|Q1DEJ2|RNZ_MYXXD Ribonuclease Z OS=Myxococcus xanthus (strain DK 1622) GN=rnz PE=3 SV=1 401 700 1.0E-15
sp|C0MDJ9|RNZ_STRS7 Ribonuclease Z OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rnz PE=3 SV=1 405 662 1.0E-15
sp|C0MAM9|RNZ_STRE4 Ribonuclease Z OS=Streptococcus equi subsp. equi (strain 4047) GN=rnz PE=3 SV=1 405 662 2.0E-15
sp|A7Z6F0|RNZ_BACMF Ribonuclease Z OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rnz PE=3 SV=1 401 702 2.0E-15
sp|B4U3M1|RNZ_STREM Ribonuclease Z OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rnz PE=3 SV=1 405 662 3.0E-15
sp|A8AWX4|RNZ_STRGC Ribonuclease Z OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rnz PE=3 SV=1 405 662 5.0E-15
sp|A8ABB4|RNZ_IGNH4 Ribonuclease Z OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rnz PE=3 SV=1 400 662 6.0E-15
sp|Q8Q032|RNZ_METMA Ribonuclease Z OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rnz PE=3 SV=1 401 700 1.0E-14
sp|Q0TFH3|RBN_ECOL5 Ribonuclease BN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rbn PE=3 SV=1 401 695 1.0E-14
sp|Q1R9E5|RBN_ECOUT Ribonuclease BN OS=Escherichia coli (strain UTI89 / UPEC) GN=rbn PE=3 SV=1 401 695 1.0E-14
sp|Q8FFK8|RBN_ECOL6 Ribonuclease BN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rbn PE=3 SV=1 401 695 1.0E-14
sp|A1ADC0|RBN_ECOK1 Ribonuclease BN OS=Escherichia coli O1:K1 / APEC GN=rbn PE=3 SV=1 401 695 1.0E-14
sp|B7MG36|RBN_ECO45 Ribonuclease BN OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rbn PE=3 SV=1 401 695 1.0E-14
sp|A5GN87|RNZ_SYNPW Ribonuclease Z OS=Synechococcus sp. (strain WH7803) GN=rnz PE=3 SV=1 401 712 2.0E-14
sp|O58883|RNZ_PYRHO Ribonuclease Z OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnz PE=3 SV=1 401 664 2.0E-14
sp|A3CNR9|RNZ_STRSV Ribonuclease Z OS=Streptococcus sanguinis (strain SK36) GN=rnz PE=3 SV=1 405 662 2.0E-14
sp|A4VVZ0|RNZ_STRSY Ribonuclease Z OS=Streptococcus suis (strain 05ZYH33) GN=rnz PE=3 SV=1 405 700 2.0E-14
sp|A4W299|RNZ_STRS2 Ribonuclease Z OS=Streptococcus suis (strain 98HAH33) GN=rnz PE=3 SV=1 405 700 2.0E-14
sp|A7MHT9|RBN_CROS8 Ribonuclease BN OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rbn PE=3 SV=1 405 662 3.0E-14
sp|B7MXV1|RBN_ECO81 Ribonuclease BN OS=Escherichia coli O81 (strain ED1a) GN=rbn PE=3 SV=1 401 695 4.0E-14
sp|B1YLU8|RNZ_EXIS2 Ribonuclease Z OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rnz PE=3 SV=1 405 662 4.0E-14
sp|B7UFT1|RBN_ECO27 Ribonuclease BN OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rbn PE=3 SV=1 401 695 4.0E-14
sp|Q9UZP4|RNZ_PYRAB Ribonuclease Z OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnz PE=3 SV=1 401 664 7.0E-14
sp|A6UUY8|RNZ_META3 Ribonuclease Z OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rnz PE=3 SV=1 401 662 7.0E-14
sp|C0Q055|RBN_SALPC Ribonuclease BN OS=Salmonella paratyphi C (strain RKS4594) GN=rbn PE=3 SV=1 401 662 1.0E-13
sp|B4EUI8|RBN_PROMH Ribonuclease BN OS=Proteus mirabilis (strain HI4320) GN=rbn PE=3 SV=1 405 662 3.0E-13
sp|B2GBD1|RNZ_LACF3 Ribonuclease Z OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rnz PE=3 SV=1 401 677 3.0E-13
sp|Q0I7X5|RNZ_SYNS3 Ribonuclease Z OS=Synechococcus sp. (strain CC9311) GN=rnz PE=3 SV=1 401 682 3.0E-13
sp|P0A8V1|RBN_SHIFL Ribonuclease BN OS=Shigella flexneri GN=rbn PE=3 SV=1 401 695 4.0E-13
sp|B6I7L2|RBN_ECOSE Ribonuclease BN OS=Escherichia coli (strain SE11) GN=rbn PE=3 SV=1 401 695 4.0E-13
sp|P0A8V0|RBN_ECOLI Ribonuclease BN OS=Escherichia coli (strain K12) GN=rbn PE=1 SV=1 401 695 4.0E-13
sp|B1IXR8|RBN_ECOLC Ribonuclease BN OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rbn PE=3 SV=1 401 695 4.0E-13
sp|A8A2D6|RBN_ECOHS Ribonuclease BN OS=Escherichia coli O9:H4 (strain HS) GN=rbn PE=3 SV=1 401 695 4.0E-13
sp|C4ZUB1|RBN_ECOBW Ribonuclease BN OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rbn PE=3 SV=1 401 695 4.0E-13
sp|Q979A8|RNZ_THEVO Ribonuclease Z OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rnz PE=3 SV=2 401 664 5.0E-13
sp|D4GZ88|RNZ_HALVD Ribonuclease Z OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rnz PE=1 SV=1 401 682 5.0E-13
sp|Q8XCZ0|RBN_ECO57 Ribonuclease BN OS=Escherichia coli O157:H7 GN=rbn PE=3 SV=2 401 695 5.0E-13
sp|B7NNU8|RBN_ECO7I Ribonuclease BN OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rbn PE=3 SV=1 401 695 6.0E-13
sp|B7M5V1|RBN_ECO8A Ribonuclease BN OS=Escherichia coli O8 (strain IAI1) GN=rbn PE=3 SV=1 401 695 6.0E-13
sp|B7LAT4|RBN_ECO55 Ribonuclease BN OS=Escherichia coli (strain 55989 / EAEC) GN=rbn PE=3 SV=1 401 695 6.0E-13
sp|A7ZP87|RBN_ECO24 Ribonuclease BN OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rbn PE=3 SV=1 401 695 6.0E-13
sp|B2TW54|RBN_SHIB3 Ribonuclease BN OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rbn PE=3 SV=1 401 695 6.0E-13
sp|B7N5N4|RBN_ECOLU Ribonuclease BN OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rbn PE=3 SV=1 401 695 6.0E-13
sp|C1CQF2|RNZ_STRZT Ribonuclease Z OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rnz PE=3 SV=1 405 700 7.0E-13
sp|C1CJE0|RNZ_STRZP Ribonuclease Z OS=Streptococcus pneumoniae (strain P1031) GN=rnz PE=3 SV=1 405 700 7.0E-13
sp|B2IMY3|RNZ_STRPS Ribonuclease Z OS=Streptococcus pneumoniae (strain CGSP14) GN=rnz PE=3 SV=1 405 700 7.0E-13
sp|B1IAL2|RNZ_STRPI Ribonuclease Z OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rnz PE=3 SV=1 405 700 7.0E-13
sp|C1C636|RNZ_STRP7 Ribonuclease Z OS=Streptococcus pneumoniae (strain 70585) GN=rnz PE=3 SV=1 405 700 7.0E-13
sp|Q97Z88|RNZ_SULSO Ribonuclease Z OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rnz PE=3 SV=1 401 664 8.0E-13
sp|C1CD41|RNZ_STRZJ Ribonuclease Z OS=Streptococcus pneumoniae (strain JJA) GN=rnz PE=3 SV=1 405 700 8.0E-13
sp|Q8DQN1|RNZ_STRR6 Ribonuclease Z OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rnz PE=3 SV=1 405 700 8.0E-13
sp|Q97RW2|RNZ_STRPN Ribonuclease Z OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rnz PE=3 SV=1 405 700 8.0E-13
sp|B8ZMQ6|RNZ_STRPJ Ribonuclease Z OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rnz PE=3 SV=1 405 700 8.0E-13
sp|Q04LL3|RNZ_STRP2 Ribonuclease Z OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rnz PE=3 SV=1 405 700 8.0E-13
sp|Q9HJ19|RNZ_THEAC Ribonuclease Z OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rnz PE=3 SV=2 401 664 1.0E-12
sp|B9DUP5|RNZ_STRU0 Ribonuclease Z OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rnz PE=3 SV=1 405 662 1.0E-12
sp|P60195|RBN_SALTY Ribonuclease BN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|P60194|RBN_SALTI Ribonuclease BN OS=Salmonella typhi GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|B5BCN2|RBN_SALPK Ribonuclease BN OS=Salmonella paratyphi A (strain AKU_12601) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|A9N598|RBN_SALPB Ribonuclease BN OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|Q5PN69|RBN_SALPA Ribonuclease BN OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|B4TBI0|RBN_SALHS Ribonuclease BN OS=Salmonella heidelberg (strain SL476) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|B5FPF2|RBN_SALDC Ribonuclease BN OS=Salmonella dublin (strain CT_02021853) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|Q57M43|RBN_SALCH Ribonuclease BN OS=Salmonella choleraesuis (strain SC-B67) GN=rbn PE=3 SV=2 401 662 1.0E-12
sp|B5EZJ2|RBN_SALA4 Ribonuclease BN OS=Salmonella agona (strain SL483) GN=rbn PE=3 SV=1 401 662 1.0E-12
sp|B8DBV5|RNZ_LISMH Ribonuclease Z OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rnz PE=3 SV=1 401 662 1.0E-12
sp|Q03W55|RNZ_LEUMM Ribonuclease Z OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rnz PE=3 SV=1 405 662 2.0E-12
sp|B5RCD8|RBN_SALG2 Ribonuclease BN OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rbn PE=3 SV=1 401 662 2.0E-12
sp|B5R2Z4|RBN_SALEP Ribonuclease BN OS=Salmonella enteritidis PT4 (strain P125109) GN=rbn PE=3 SV=1 401 662 2.0E-12
sp|Q8U182|RNZ_PYRFU Ribonuclease Z OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnz PE=1 SV=1 401 664 2.0E-12
sp|Q58897|RNZ_METJA Ribonuclease Z OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rnz PE=1 SV=2 398 662 2.0E-12
sp|Q7NDW3|RNZ_GLOVI Ribonuclease Z OS=Gloeobacter violaceus (strain PCC 7421) GN=rnz PE=3 SV=1 405 664 3.0E-12
sp|C4L3C2|RNZ_EXISA Ribonuclease Z OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rnz PE=3 SV=1 401 697 4.0E-12
sp|Q6KZJ4|RNZ_PICTO Ribonuclease Z OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rnz PE=3 SV=1 401 661 4.0E-12
sp|Q834G2|RNZ_ENTFA Ribonuclease Z OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rnz PE=3 SV=1 405 677 4.0E-12
sp|Q6LYT2|RNZ_METMP Ribonuclease Z OS=Methanococcus maripaludis (strain S2 / LL) GN=rnz PE=3 SV=1 401 700 7.0E-12
sp|Q11TT4|RNZ_CYTH3 Ribonuclease Z OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rnz PE=3 SV=1 401 662 8.0E-12
sp|Q7VAN0|RNZ_PROMA Ribonuclease Z OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnz PE=3 SV=1 401 702 3.0E-11
sp|Q9HN60|RNZ_HALSA Ribonuclease Z OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rnz PE=3 SV=1 398 662 3.0E-11
sp|B0R7E2|RNZ_HALS3 Ribonuclease Z OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rnz PE=3 SV=1 398 662 3.0E-11
sp|B7K762|RNZ_CYAP7 Ribonuclease Z OS=Cyanothece sp. (strain PCC 7424) GN=rnz PE=3 SV=1 401 664 3.0E-11
sp|Q73LB4|RNZ_TREDE Ribonuclease Z OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rnz PE=3 SV=1 398 664 4.0E-11
sp|A1RRK1|RNZ_PYRIL Ribonuclease Z OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rnz PE=3 SV=1 401 662 5.0E-11
sp|C6A2P3|RNZ_THESM Ribonuclease Z OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rnz PE=3 SV=1 401 664 7.0E-11
sp|Q88VG6|RNZ_LACPL Ribonuclease Z OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rnz PE=3 SV=1 405 700 7.0E-11
sp|Q1IA50|RNZ_PSEE4 Ribonuclease Z OS=Pseudomonas entomophila (strain L48) GN=rnz PE=3 SV=1 405 662 8.0E-11
sp|Q1WT50|RNZ_LACS1 Ribonuclease Z OS=Lactobacillus salivarius (strain UCC118) GN=rnz PE=3 SV=1 405 662 8.0E-11
sp|A5W1E8|RNZ_PSEP1 Ribonuclease Z OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnz PE=3 SV=1 402 662 2.0E-10
sp|Q88FQ4|RNZ_PSEPK Ribonuclease Z OS=Pseudomonas putida (strain KT2440) GN=rnz PE=3 SV=1 402 662 3.0E-10
sp|B2J3C7|RNZ_NOSP7 Ribonuclease Z OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rnz PE=3 SV=1 401 664 4.0E-10
sp|B0KMS1|RNZ_PSEPG Ribonuclease Z OS=Pseudomonas putida (strain GB-1) GN=rnz PE=3 SV=1 402 662 5.0E-10
sp|A9AB37|RNZ_METM6 Ribonuclease Z OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rnz PE=3 SV=1 401 662 1.0E-09
sp|A6VFJ7|RNZ_METM7 Ribonuclease Z OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rnz PE=3 SV=1 401 662 2.0E-09
sp|B6YT50|RNZ_THEON Ribonuclease Z OS=Thermococcus onnurineus (strain NA1) GN=rnz PE=3 SV=1 401 661 2.0E-09
sp|A6UN58|RNZ_METVS Ribonuclease Z OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rnz PE=3 SV=1 401 662 2.0E-09
sp|B6IRV8|RNZ_RHOCS Ribonuclease Z OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rnz PE=3 SV=1 405 661 4.0E-09
sp|Q9YAV8|RNZ_AERPE Ribonuclease Z OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rnz PE=3 SV=2 402 662 4.0E-09
sp|Q5JE70|RNZ_THEKO Ribonuclease Z OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnz PE=3 SV=1 401 661 7.0E-09
sp|B1J6H3|RNZ_PSEPW Ribonuclease Z OS=Pseudomonas putida (strain W619) GN=rnz PE=3 SV=1 405 482 4.0E-08
sp|Q8NWE6|RNZ_STAAW Ribonuclease Z OS=Staphylococcus aureus (strain MW2) GN=rnz PE=3 SV=1 401 662 6.0E-08
sp|Q6G960|RNZ_STAAS Ribonuclease Z OS=Staphylococcus aureus (strain MSSA476) GN=rnz PE=3 SV=1 401 662 6.0E-08
sp|A8Z2D7|RNZ_STAAT Ribonuclease Z OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|A6QH51|RNZ_STAAE Ribonuclease Z OS=Staphylococcus aureus (strain Newman) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|Q5HFR8|RNZ_STAAC Ribonuclease Z OS=Staphylococcus aureus (strain COL) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|Q2FY67|RNZ_STAA8 Ribonuclease Z OS=Staphylococcus aureus (strain NCTC 8325) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|Q2FGM9|RNZ_STAA3 Ribonuclease Z OS=Staphylococcus aureus (strain USA300) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|P60197|RNZ_STAAN Ribonuclease Z OS=Staphylococcus aureus (strain N315) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|P60196|RNZ_STAAM Ribonuclease Z OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|A5IT32|RNZ_STAA9 Ribonuclease Z OS=Staphylococcus aureus (strain JH9) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|A6U1X3|RNZ_STAA2 Ribonuclease Z OS=Staphylococcus aureus (strain JH1) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|A7X2M2|RNZ_STAA1 Ribonuclease Z OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rnz PE=3 SV=1 401 662 7.0E-08
sp|Q6GGJ4|RNZ_STAAR Ribonuclease Z OS=Staphylococcus aureus (strain MRSA252) GN=rnz PE=3 SV=1 401 662 8.0E-08
sp|Q2YYA2|RNZ_STAAB Ribonuclease Z OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rnz PE=3 SV=1 401 662 8.0E-08
sp|A7GSG2|RNZ_BACCN Ribonuclease Z OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rnz PE=3 SV=1 401 662 8.0E-08
sp|B5XL36|RNZ_STRPZ Ribonuclease Z OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q48TY8|RNZ_STRPM Ribonuclease Z OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|A2REY2|RNZ_STRPG Ribonuclease Z OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q1J705|RNZ_STRPF Ribonuclease Z OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q1JH87|RNZ_STRPD Ribonuclease Z OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q8P1A6|RNZ_STRP8 Ribonuclease Z OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q5XCH7|RNZ_STRP6 Ribonuclease Z OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|P0DF23|RNZ_STRPQ Ribonuclease Z OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q1JM42|RNZ_STRPC Ribonuclease Z OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|Q1JC59|RNZ_STRPB Ribonuclease Z OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|P0DF22|RNZ_STRP3 Ribonuclease Z OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|P60199|RNZ_STRP1 Ribonuclease Z OS=Streptococcus pyogenes serotype M1 GN=rnz PE=3 SV=1 598 662 1.0E-07
sp|A2C4C2|RNZ_PROM1 Ribonuclease Z OS=Prochlorococcus marinus (strain NATL1A) GN=rnz PE=3 SV=1 597 702 3.0E-07
sp|A1U2M9|RNZ_MARHV Ribonuclease Z OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rnz PE=3 SV=1 405 662 4.0E-07
sp|Q46JB7|RNZ_PROMT Ribonuclease Z OS=Prochlorococcus marinus (strain NATL2A) GN=rnz PE=3 SV=1 597 702 5.0E-07
sp|Q8DT90|RNZ_STRMU Ribonuclease Z OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rnz PE=3 SV=1 598 662 5.0E-07
sp|Q9CHT8|RNZ_LACLA Ribonuclease Z OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnz PE=3 SV=1 593 667 6.0E-07
sp|C5A5S2|RNZ_THEGJ Ribonuclease Z OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rnz PE=3 SV=1 401 661 9.0E-07
sp|B5E2R6|RNZ_STRP4 Ribonuclease Z OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rnz PE=3 SV=1 598 700 1.0E-06
sp|Q8DZ99|RNZ_STRA5 Ribonuclease Z OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rnz PE=3 SV=1 598 662 1.0E-06
sp|Q8E4W1|RNZ_STRA3 Ribonuclease Z OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rnz PE=3 SV=1 598 662 1.0E-06
sp|Q3K0P4|RNZ_STRA1 Ribonuclease Z OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rnz PE=3 SV=1 598 662 1.0E-06
sp|B9KYQ3|RNZ_THERP Ribonuclease Z OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rnz PE=3 SV=1 402 495 2.0E-06
sp|Q5UZJ9|RNZ_HALMA Ribonuclease Z OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rnz PE=3 SV=1 398 478 2.0E-06
sp|C3MPH2|RNZ_SULIL Ribonuclease Z OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rnz PE=3 SV=1 401 503 3.0E-06
sp|C3NDQ2|RNZ_SULIY Ribonuclease Z OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rnz PE=3 SV=1 401 503 3.0E-06
sp|C3NHZ9|RNZ_SULIN Ribonuclease Z OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rnz PE=3 SV=1 401 503 3.0E-06
sp|C3MYG0|RNZ_SULIM Ribonuclease Z OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rnz PE=3 SV=1 401 503 3.0E-06
sp|C4KGQ7|RNZ_SULIK Ribonuclease Z OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rnz PE=3 SV=1 401 503 3.0E-06
sp|C3N554|RNZ_SULIA Ribonuclease Z OS=Sulfolobus islandicus (strain M.16.27) GN=rnz PE=3 SV=1 401 503 3.0E-06
sp|Q89ZN1|RNZ_BACTN Ribonuclease Z OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rnz PE=3 SV=1 405 684 5.0E-06
sp|B0CE23|RNZ_ACAM1 Ribonuclease Z OS=Acaryochloris marina (strain MBIC 11017) GN=rnz PE=3 SV=1 401 477 7.0E-06
sp|Q031A3|RNZ_LACLS Ribonuclease Z OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rnz PE=3 SV=1 598 667 1.0E-05
sp|A2RIV7|RNZ_LACLM Ribonuclease Z OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rnz PE=3 SV=1 598 667 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|037870
MRAIFLTRVASATVGGLGGAIASVAKTVHSLTVVGPPGIRHFIASLRGFIRGILRFSLFEYQSRGENRKPEAIYT
DENIAVYPIPITPTIVADEPSERRHSNLDANKSPRIMKAKTAVGLTADEVRQAAVYHMFKRNSANIRPEVLDDEP
IADDSERWVPTWLHGNRLPFFSFPKTFPQSSTLAYVVIGPRPEKPSAKDIPPQPHPVVIILDVPTPDFIPSVLRM
FDNECAPFLYTDPHHGGNYKIKAIYHMLGRRVAFDGRYYGFLHGFSSHTKHFISCPELSRDYFTFPLNAWRLYQL
TLLDVKTFPFLMRRVTKPQHTSCLVLRSTELMRPGLQIRLDEDAFATGSIVYNFGSPAQTLSSILQIAPLPKQVQ
AAFSSARRNIFRHPDFQRSEKRISAKVVCLGTGKTIPNQFRNVISTLLVTPDGHIMLDCGEGTAQQLERRYGVET
KNMLRDLKCIFISHAHADHHLGLISLLRRRRMLFDRPKQPLYIVATRLVHLFLKEYQDLEDIGLYDDPTQDGIIH
ILADALNYRHDEYPITGAWRMLGKEPWLDMELSRQHNLDMCEKLNLASFETIDVYHSTRAFGTLIRHKAEWSVTY
SGDTRPTINLVKLGYGTDLLIHEASLKKGAEELALKRGHSTITQAIHVGHDMRAKNVLLTHLPPYAVTLPSTHLA
KQYENTDDWGGPVVAVANDFMEIDLDKFWKANLCNEAIADCHHIAFQEEKKSIAQLLWELLPEESLVCSPNIAYL
FSSPPERKTGKARSENRRVPQARSDVRGARKAWSEDRKAPEALSNVRGVPKTRIKDSRAPKAWSDFREVPKARSE
DDRAPKMISKKRVFSNNGIQ*
Coding >Agabi119p4|037870
ATGAGAGCTATATTCCTCACCCGTGTCGCCTCTGCAACCGTGGGGGGACTTGGCGGTGCCATTGCCTCTGTCGCC
AAGACTGTTCATTCACTTACCGTGGTTGGGCCTCCCGGTATCCGGCATTTCATTGCGTCGTTGCGCGGTTTCATA
AGGGGGATACTCAGATTCTCATTATTTGAATATCAATCTCGAGGGGAAAATCGGAAACCAGAAGCCATCTACACA
GACGAGAATATTGCTGTATATCCGATTCCAATTACTCCTACCATTGTTGCGGACGAACCCTCGGAAAGGCGACAT
TCAAATTTAGATGCTAACAAGTCACCACGCATTATGAAAGCGAAGACAGCGGTAGGATTAACTGCAGATGAAGTG
CGGCAGGCCGCCGTCTATCACATGTTTAAAAGAAATTCGGCAAACATCCGGCCGGAGGTCTTGGACGATGAGCCA
ATTGCGGACGACAGTGAAAGATGGGTCCCCACTTGGCTGCACGGGAATCGGCTACCTTTCTTCTCGTTCCCAAAA
ACCTTTCCCCAGTCATCGACTCTCGCTTACGTTGTTATTGGACCCCGCCCAGAAAAACCTTCTGCCAAAGATATC
CCTCCACAGCCTCATCCGGTGGTTATAATTCTCGATGTCCCAACTCCGGACTTCATACCATCTGTTCTTCGCATG
TTCGATAATGAATGTGCACCCTTTCTGTATACTGATCCGCACCATGGCGGAAATTATAAAATAAAGGCCATATAT
CATATGCTCGGCCGACGCGTTGCCTTTGATGGTCGATATTACGGCTTTCTACATGGATTTTCATCGCATACCAAG
CATTTCATATCTTGTCCAGAACTGAGCCGGGATTATTTCACGTTTCCCCTCAATGCGTGGCGTCTATATCAGCTA
ACACTACTCGATGTGAAAACGTTCCCTTTTCTTATGCGGCGAGTCACAAAACCTCAACATACATCTTGCCTTGTA
TTGCGCAGCACTGAGCTCATGCGTCCGGGCCTACAAATTCGTCTTGATGAAGATGCTTTCGCAACGGGATCAATC
GTCTACAATTTCGGATCGCCAGCTCAAACTTTGAGTTCCATCCTTCAGATAGCACCGCTTCCTAAACAAGTGCAG
GCTGCCTTTTCATCTGCGCGACGCAACATTTTCCGTCATCCAGATTTTCAGAGAAGCGAGAAAAGAATATCGGCT
AAAGTCGTTTGTTTGGGTACCGGGAAAACTATACCTAATCAATTCAGAAATGTCATCTCGACGCTACTGGTGACA
CCAGATGGCCATATCATGCTAGATTGTGGTGAAGGGACAGCCCAACAGTTGGAACGTCGATATGGGGTGGAAACC
AAAAATATGTTACGCGACCTAAAGTGTATCTTCATCAGTCATGCCCATGCAGACCATCATTTGGGATTGATAAGT
CTCCTGAGGCGTCGACGAATGTTGTTTGATCGACCCAAACAACCTCTTTATATAGTAGCAACTCGTCTCGTGCAT
CTCTTTCTCAAAGAGTACCAAGATTTGGAAGATATTGGATTGTACGATGATCCGACACAAGATGGAATCATTCAT
ATTTTGGCGGATGCGTTGAATTATAGACATGATGAATACCCGATTACAGGAGCGTGGCGAATGCTTGGAAAGGAA
CCATGGTTGGACATGGAACTTTCACGGCAACATAATTTAGATATGTGCGAGAAGTTGAACCTGGCTAGTTTCGAA
ACGATTGATGTGTATCATTCAACAAGAGCTTTCGGGACACTTATACGACACAAGGCTGAATGGAGCGTAACATAT
TCTGGCGACACAAGGCCGACGATAAACCTGGTCAAACTCGGTTATGGTACTGATTTGCTCATTCATGAAGCAAGT
TTAAAGAAGGGTGCAGAAGAACTTGCATTGAAGCGAGGCCATAGCACTATCACACAAGCGATCCATGTTGGACAC
GACATGCGCGCCAAGAACGTTCTCCTGACCCATCTTCCTCCCTACGCAGTTACCCTTCCTTCAACCCACCTCGCC
AAACAATACGAAAACACCGACGATTGGGGGGGCCCCGTCGTAGCCGTTGCCAACGATTTCATGGAAATCGACTTG
GACAAATTCTGGAAGGCTAACTTGTGTAATGAGGCTATTGCAGATTGTCATCATATCGCCTTTCAGGAAGAGAAG
AAGAGTATAGCGCAATTGTTGTGGGAGCTTTTACCTGAAGAGTCGCTTGTTTGTTCGCCGAATATCGCGTACTTG
TTTAGTTCCCCCCCGGAACGGAAGACTGGCAAGGCGCGGAGTGAGAATCGTAGAGTTCCTCAGGCCCGTAGTGAT
GTTCGTGGAGCAAGAAAGGCCTGGAGCGAGGATCGTAAAGCCCCTGAAGCATTGAGTAATGTCCGTGGAGTACCT
AAGACTAGGATCAAGGATAGTAGAGCGCCTAAGGCCTGGAGCGATTTTCGTGAAGTACCTAAGGCTCGGAGTGAG
GATGATAGAGCCCCAAAAATGATTAGCAAAAAACGCGTGTTTAGTAATAATGGAATACAGTAA
Transcript >Agabi119p4|037870
ATGAGAGCTATATTCCTCACCCGTGTCGCCTCTGCAACCGTGGGGGGACTTGGCGGTGCCATTGCCTCTGTCGCC
AAGACTGTTCATTCACTTACCGTGGTTGGGCCTCCCGGTATCCGGCATTTCATTGCGTCGTTGCGCGGTTTCATA
AGGGGGATACTCAGATTCTCATTATTTGAATATCAATCTCGAGGGGAAAATCGGAAACCAGAAGCCATCTACACA
GACGAGAATATTGCTGTATATCCGATTCCAATTACTCCTACCATTGTTGCGGACGAACCCTCGGAAAGGCGACAT
TCAAATTTAGATGCTAACAAGTCACCACGCATTATGAAAGCGAAGACAGCGGTAGGATTAACTGCAGATGAAGTG
CGGCAGGCCGCCGTCTATCACATGTTTAAAAGAAATTCGGCAAACATCCGGCCGGAGGTCTTGGACGATGAGCCA
ATTGCGGACGACAGTGAAAGATGGGTCCCCACTTGGCTGCACGGGAATCGGCTACCTTTCTTCTCGTTCCCAAAA
ACCTTTCCCCAGTCATCGACTCTCGCTTACGTTGTTATTGGACCCCGCCCAGAAAAACCTTCTGCCAAAGATATC
CCTCCACAGCCTCATCCGGTGGTTATAATTCTCGATGTCCCAACTCCGGACTTCATACCATCTGTTCTTCGCATG
TTCGATAATGAATGTGCACCCTTTCTGTATACTGATCCGCACCATGGCGGAAATTATAAAATAAAGGCCATATAT
CATATGCTCGGCCGACGCGTTGCCTTTGATGGTCGATATTACGGCTTTCTACATGGATTTTCATCGCATACCAAG
CATTTCATATCTTGTCCAGAACTGAGCCGGGATTATTTCACGTTTCCCCTCAATGCGTGGCGTCTATATCAGCTA
ACACTACTCGATGTGAAAACGTTCCCTTTTCTTATGCGGCGAGTCACAAAACCTCAACATACATCTTGCCTTGTA
TTGCGCAGCACTGAGCTCATGCGTCCGGGCCTACAAATTCGTCTTGATGAAGATGCTTTCGCAACGGGATCAATC
GTCTACAATTTCGGATCGCCAGCTCAAACTTTGAGTTCCATCCTTCAGATAGCACCGCTTCCTAAACAAGTGCAG
GCTGCCTTTTCATCTGCGCGACGCAACATTTTCCGTCATCCAGATTTTCAGAGAAGCGAGAAAAGAATATCGGCT
AAAGTCGTTTGTTTGGGTACCGGGAAAACTATACCTAATCAATTCAGAAATGTCATCTCGACGCTACTGGTGACA
CCAGATGGCCATATCATGCTAGATTGTGGTGAAGGGACAGCCCAACAGTTGGAACGTCGATATGGGGTGGAAACC
AAAAATATGTTACGCGACCTAAAGTGTATCTTCATCAGTCATGCCCATGCAGACCATCATTTGGGATTGATAAGT
CTCCTGAGGCGTCGACGAATGTTGTTTGATCGACCCAAACAACCTCTTTATATAGTAGCAACTCGTCTCGTGCAT
CTCTTTCTCAAAGAGTACCAAGATTTGGAAGATATTGGATTGTACGATGATCCGACACAAGATGGAATCATTCAT
ATTTTGGCGGATGCGTTGAATTATAGACATGATGAATACCCGATTACAGGAGCGTGGCGAATGCTTGGAAAGGAA
CCATGGTTGGACATGGAACTTTCACGGCAACATAATTTAGATATGTGCGAGAAGTTGAACCTGGCTAGTTTCGAA
ACGATTGATGTGTATCATTCAACAAGAGCTTTCGGGACACTTATACGACACAAGGCTGAATGGAGCGTAACATAT
TCTGGCGACACAAGGCCGACGATAAACCTGGTCAAACTCGGTTATGGTACTGATTTGCTCATTCATGAAGCAAGT
TTAAAGAAGGGTGCAGAAGAACTTGCATTGAAGCGAGGCCATAGCACTATCACACAAGCGATCCATGTTGGACAC
GACATGCGCGCCAAGAACGTTCTCCTGACCCATCTTCCTCCCTACGCAGTTACCCTTCCTTCAACCCACCTCGCC
AAACAATACGAAAACACCGACGATTGGGGGGGCCCCGTCGTAGCCGTTGCCAACGATTTCATGGAAATCGACTTG
GACAAATTCTGGAAGGCTAACTTGTGTAATGAGGCTATTGCAGATTGTCATCATATCGCCTTTCAGGAAGAGAAG
AAGAGTATAGCGCAATTGTTGTGGGAGCTTTTACCTGAAGAGTCGCTTGTTTGTTCGCCGAATATCGCGTACTTG
TTTAGTTCCCCCCCGGAACGGAAGACTGGCAAGGCGCGGAGTGAGAATCGTAGAGTTCCTCAGGCCCGTAGTGAT
GTTCGTGGAGCAAGAAAGGCCTGGAGCGAGGATCGTAAAGCCCCTGAAGCATTGAGTAATGTCCGTGGAGTACCT
AAGACTAGGATCAAGGATAGTAGAGCGCCTAAGGCCTGGAGCGATTTTCGTGAAGTACCTAAGGCTCGGAGTGAG
GATGATAGAGCCCCAAAAATGATTAGCAAAAAACGCGTGTTTAGTAATAATGGAATACAGTAA
Gene >Agabi119p4|037870
ATGAGAGCTATATTCCTCACCCGTGTCGCCTCTGCAACCGTGGGGGGACTTGGCGGTGAGTAATTTTCTACTTAC
ATTTAGGAAATGTCGTTGAGGTTTGCAGGTGCCATTGCCTCTGTCGCCAAGACTGTTCATTCACTTACCGTGGTT
GGGCCTCCCGGTATCCGGCATTTCATTGCGTCGTTGCGCGGTTTCATAAGGTGAAAGATTAACCTTTTCCCATGG
AGCCTGAAGTTGACAATCACTGTTTACGACAGGGGGATACTCAGATTCTCATTATTTGAATATCAATCTCGAGGG
GAAAATCGGAAACCAGAAGCCATCTACACAGACGAGAATATTGCTGTATATCCGATTCCAATTACTCCTACCATT
GTTGCGGACGAACCCTCGGAAAGGCGACATTCAAATTTAGATGCTAACAAGTCACCACGCATTATGAAAGCGAAG
ACAGCGGTAGGATTAACTGCAGATGAAGTGCGGCAGGCCGCCGTCTATCACATGTTTAAAAGAAATTCGGCAAAC
ATCCGGGTACGTACATGCGTTAACTGTATTCTAGATTGTGGCTCACATGTCCTGTTTAAGCCGGAGGTCTTGGAC
GATGAGCCAATTGCGGACGACAGTGAAAGATGGGTCCCCACTTGGCTGCACGGGAATCGGCTACCTTTCTTCTCG
TTCCCAAAAACCTTTCCCCAGTCATCGACTCTCGCTTACGTTGTTATTGGACCCCGCCCAGAAAAACCTTCTGCC
AAAGATATCCCTCCACAGCCTCATCCGGTGGTTATAATTCTCGATGTCCCAACTCCGGACTTCATACCATCTGTT
CTTCGCATGTTCGATAATGAATGTGCACCCTTTCTGTATACTGATCCGCACCATGGCGGAAATTATAAAATAAAG
GCCATATATCATATGCTCGGCCGACGCGTTGCCTTTGATGGTCGATATTACGGCTTTCTACATGGATTTTCATCG
CATACCAAGCATTTCATATCTTGTCCAGAACTGAGCCGGGATTATTTCACGTTTCCCCTCAATGCGTGGCGTCTA
TATCAGCTAACACTACTCGATGTGAAAACGTTCCCTTTTCTTATGCGGCGAGTCACAAAACCTCAACATAGTGAG
TCGGTTCATCGTCAATGAATGTTCATTAATTTTGGTCTATCAGCATCTTGCCTTGTATTGCGCAGCACTGAGCTC
ATGCGTCCGGGCCTACAAATTCGTCTTGATGAAGATGCTTTCGCAACGGGATCAATCGTCTACAATTTCGGATCG
CCAGCTCAAACTTTGAGTTCCATCCTTCAGATAGCACCGCTTCCTAAACAAGTGCAGGCTGCCTTTTCATCTGCG
CGACGCAACATTTTCCGTCATCCAGATTTTCAGAGAAGCGAGAAAAGAATATCGGCTAAAGTCGTTTGTTTGGGT
ACCGGGAAAACTATACCTAATCAATTCAGAAATGGTAAATTCTTCATTATTGTGAATTATTGGTTTTGCATTGTT
AACTTTCCTATTCCCAAACCCCTCTTGCAGTCATCTCGACGCTACTGGTGACACCAGATGGCCATATCATGCTAG
ATTGTGGTGAAGGGACAGCCCAACAGTTGGAACGTCGATATGGGGTGGAAACCAAAAATATGTTACGCGACCTAA
AGTGTATCTTCATCAGTCATGCCCATGCAGACCATCATTTGGGATTGATAAGTCTCCTGAGGCGTCGACGAGTTG
GTTATTTCTTCATCATGAAACGACCTACTAATTAATGTATTCAGATGTTGTTTGATCGACCCAAACAACCTCTTT
ATATAGTAGCAACTCGTCTCGTGCATCTCTTTCTCAAAGAGTACCAAGATTTGGAAGATATTGGATTGTACGATG
ATCCGACACAAGATGGAATCATTCATATTTTGGCGGATGCGTTGAATTATAGACATGATGAATACCCGATTACAG
GAGCGTGGCGAATGCTTGGAAAGGAACCATGGTTGGACATGGAACTGTATGTTTCCATTATTTTCACTTCTTTGT
GGTATACTCTGATAACATTAATCGATTGCAAGTTCACGGCAACATAATTTAGATATGTGCGAGAAGTTGAACCTG
GCTAGTTTCGAAACGATTGATGTGTATCATTCAACAAGAGCTTTCGGGACACTTATACGACACAAGGCTGAATGG
AGCGTAACGTGAGTCTCCTTTTTTCAGCGTTTGAATAGACTTTTCCTAATCAGCTACTCTGTTATAGATATTCTG
GCGACACAAGGCCGACGATAAACCTGGTCAAACTCGGTTATGGTACTGATTTGCTCATTCATGAAGCAAGTTTAA
AGAAGGGTGCAGAAGAACTTGCATTGAAGCGAGGCCATAGCACTATCACACAAGCGATCCATGTTGGACACGAGT
ATGTATCACCTTCTATCTACCTGCATTTCAAAAAAAGATAAAGAAAACTGAATCCCTGATTATAATAGCATGCGC
GCCAAGAACGTTCTCCTGACCCATCTTCCTCCCTACGCAGTTACCCTTCCTTCAACCCACCTCGCCAAACAATAC
GAAAACACCGACGATTGGGGGGGCCCCGTCGTAGCCGTTGCCAACGATTTCATGGAAATCGACTTGGACAAATTC
TGGAAGGCTAACTTGTGTAATGAGGCTATTGCAGATTGTCATCATATCGCCTTTCAGGAAGAGAAGAAGAGTATA
GCGCAATTGTTGTGGGAGCTTTTACCTGAAGAGTCGCTTGTTTGTTCGCCGAATATCGCGTACTTGTTTAGTTCC
CCCCCGGAACGGAAGACTGGCAAGGCGCGGAGTGAGAATCGTAGAGTTCCTCAGGCCCGTAGTGATGTTCGTGGA
GCAAGAAAGGCCTGGAGCGAGGATCGTAAAGCCCCTGAAGCATTGAGTAATGTCCGTGGAGTACCTAAGACTAGG
ATCAAGGATAGTAGAGCGCCTAAGGCCTGGAGCGATTTTCGTGAAGTACCTAAGGCTCGGAGTGAGGATGATAGA
GCCCCAAAAATGATTAGCAAAAAACGCGTGTTTAGTAATAATGGAATACAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail