Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|037620
Gene name
Locationscaffold_13:1044428..1045772
Strand-
Gene length (bp)1344
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01975 SurE Survival protein SurE 1.4E-24 23 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 23 181 7.0E-19
sp|Q1MQB1|SURE_LAWIP 5'-nucleotidase SurE OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=surE PE=3 SV=1 21 146 3.0E-13
sp|Q24WI0|SURE_DESHY 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain Y51) GN=surE PE=3 SV=1 23 155 2.0E-12
sp|B8FYS8|SURE_DESHD 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=surE PE=3 SV=1 23 155 2.0E-12
sp|A0KGH8|SURE_AERHH 5'-nucleotidase SurE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=surE PE=3 SV=1 21 146 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 23 181 7.0E-19
sp|Q1MQB1|SURE_LAWIP 5'-nucleotidase SurE OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=surE PE=3 SV=1 21 146 3.0E-13
sp|Q24WI0|SURE_DESHY 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain Y51) GN=surE PE=3 SV=1 23 155 2.0E-12
sp|B8FYS8|SURE_DESHD 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=surE PE=3 SV=1 23 155 2.0E-12
sp|A0KGH8|SURE_AERHH 5'-nucleotidase SurE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=surE PE=3 SV=1 21 146 6.0E-12
sp|Q72H70|SURE1_THET2 5'-nucleotidase SurE 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=surE1 PE=3 SV=1 21 155 2.0E-11
sp|A3CVB4|SURE_METMJ 5'-nucleotidase SurE OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=surE PE=3 SV=1 22 148 3.0E-11
sp|C5A6M8|SURE_THEGJ 5'-nucleotidase SurE OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=surE PE=3 SV=1 21 146 4.0E-11
sp|Q30YV9|SURE_DESAG 5'-nucleotidase SurE OS=Desulfovibrio alaskensis (strain G20) GN=surE PE=3 SV=1 23 146 7.0E-11
sp|B8DN39|SURE_DESVM 5'-nucleotidase SurE OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=surE PE=3 SV=1 23 146 8.0E-11
sp|Q8TUG3|SURE_METAC 5'-nucleotidase SurE OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=surE PE=3 SV=1 20 148 8.0E-11
sp|Q0W2Q3|SURE_METAR 5'-nucleotidase SurE OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=surE PE=3 SV=1 22 146 9.0E-11
sp|Q5JE78|SURE_THEKO 5'-nucleotidase SurE OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=surE PE=3 SV=1 21 146 1.0E-10
sp|O29320|SURE_ARCFU 5'-nucleotidase SurE OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=surE PE=3 SV=1 21 148 1.0E-10
sp|C4XNX3|SURE_DESMR 5'-nucleotidase SurE OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=surE PE=3 SV=1 21 176 1.0E-10
sp|O83434|SURE_TREPA 5'-nucleotidase SurE OS=Treponema pallidum (strain Nichols) GN=surE PE=3 SV=1 21 146 1.0E-10
sp|Q12U23|SURE_METBU 5'-nucleotidase SurE OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=surE PE=3 SV=1 20 148 2.0E-10
sp|Q7MHQ7|SURE_VIBVY 5'-nucleotidase SurE OS=Vibrio vulnificus (strain YJ016) GN=surE PE=3 SV=1 22 146 2.0E-10
sp|Q8DC57|SURE_VIBVU 5'-nucleotidase SurE OS=Vibrio vulnificus (strain CMCP6) GN=surE PE=3 SV=1 22 146 2.0E-10
sp|Q8PX31|SURE_METMA 5'-nucleotidase SurE OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=surE PE=3 SV=1 22 148 3.0E-10
sp|Q6LYE0|SURE_METMP 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain S2 / LL) GN=surE PE=3 SV=2 21 181 4.0E-10
sp|Q46D82|SURE_METBF 5'-nucleotidase SurE OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=surE PE=3 SV=1 20 148 4.0E-10
sp|B8CWH0|SURE_HALOH 5'-nucleotidase SurE OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=surE PE=3 SV=1 21 157 5.0E-10
sp|Q8TY72|SURE_METKA 5'-nucleotidase SurE OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=surE PE=3 SV=1 21 148 7.0E-10
sp|A0B8M6|SURE_METTP 5'-nucleotidase SurE OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=surE PE=3 SV=1 21 148 9.0E-10
sp|A9AAP6|SURE_METM6 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=surE PE=3 SV=1 21 181 1.0E-09
sp|A4SRB6|SURE_AERS4 5'-nucleotidase SurE OS=Aeromonas salmonicida (strain A449) GN=surE PE=3 SV=1 21 146 2.0E-09
sp|A5G4S8|SURE_GEOUR 5'-nucleotidase SurE OS=Geobacter uraniireducens (strain Rf4) GN=surE PE=3 SV=1 21 146 2.0E-09
sp|A4FXC7|SURE_METM5 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=surE PE=3 SV=1 21 181 2.0E-09
sp|B8HSQ9|SURE_CYAP4 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=surE PE=3 SV=1 21 159 2.0E-09
sp|P74709|SURE_SYNY3 5'-nucleotidase SurE OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=surE PE=3 SV=1 23 156 3.0E-09
sp|B3CLR5|SURE_WOLPP 5'-nucleotidase SurE OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=surE PE=3 SV=1 23 146 3.0E-09
sp|Q8RA90|SURE_CALS4 5'-nucleotidase SurE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=surE PE=3 SV=1 23 152 4.0E-09
sp|O67004|SURE_AQUAE 5'-nucleotidase SurE OS=Aquifex aeolicus (strain VF5) GN=surE PE=1 SV=1 24 182 4.0E-09
sp|A1VCE4|SURE_DESVV 5'-nucleotidase SurE OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=surE PE=3 SV=1 21 149 4.0E-09
sp|B2VA83|SURE_SULSY 5'-nucleotidase SurE OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=surE PE=3 SV=1 21 181 4.0E-09
sp|Q72A55|SURE_DESVH 5'-nucleotidase SurE OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=surE PE=3 SV=1 21 149 5.0E-09
sp|Q2FLE8|SURE_METHJ 5'-nucleotidase SurE OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=surE PE=3 SV=1 23 148 5.0E-09
sp|Q3A4N5|SURE_PELCD 5'-nucleotidase SurE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=surE PE=3 SV=1 23 154 6.0E-09
sp|B4SR92|SURE_STRM5 5'-nucleotidase SurE OS=Stenotrophomonas maltophilia (strain R551-3) GN=surE PE=3 SV=1 21 146 6.0E-09
sp|B2FK94|SURE_STRMK 5'-nucleotidase SurE OS=Stenotrophomonas maltophilia (strain K279a) GN=surE PE=3 SV=1 21 146 7.0E-09
sp|A1ASL7|SURE_PELPD 5'-nucleotidase SurE OS=Pelobacter propionicus (strain DSM 2379) GN=surE PE=3 SV=1 23 146 8.0E-09
sp|Q899M5|SURE_CLOTE 5'-nucleotidase SurE OS=Clostridium tetani (strain Massachusetts / E88) GN=surE PE=3 SV=1 21 148 8.0E-09
sp|Q8DI06|SURE_THEEB 5'-nucleotidase SurE OS=Thermosynechococcus elongatus (strain BP-1) GN=surE PE=3 SV=1 21 146 9.0E-09
sp|B2U9T8|SURE_RALPJ 5'-nucleotidase SurE OS=Ralstonia pickettii (strain 12J) GN=surE PE=3 SV=1 23 187 1.0E-08
sp|B8J2G2|SURE_DESDA 5'-nucleotidase SurE OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=surE PE=3 SV=1 21 151 1.0E-08
sp|Q3ADI0|SURE_CARHZ 5'-nucleotidase SurE OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=surE PE=3 SV=1 21 152 1.0E-08
sp|Q8YMT3|SURE_NOSS1 5'-nucleotidase SurE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|B0RTZ9|SURE_XANCB 5'-nucleotidase SurE OS=Xanthomonas campestris pv. campestris (strain B100) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|Q8P9Y7|SURE_XANCP 5'-nucleotidase SurE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|Q4UTP8|SURE_XANC8 5'-nucleotidase SurE OS=Xanthomonas campestris pv. campestris (strain 8004) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|Q8PLR4|SURE_XANAC 5'-nucleotidase SurE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|Q9S4T3|SURE_LEGPH 5'-nucleotidase SurE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|A6VFZ9|SURE_METM7 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=surE PE=3 SV=1 21 181 1.0E-08
sp|Q3BUS4|SURE_XANC5 5'-nucleotidase SurE OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=surE PE=3 SV=1 21 146 1.0E-08
sp|A6UP61|SURE_METVS 5'-nucleotidase SurE OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=surE PE=3 SV=1 22 183 1.0E-08
sp|Q8Y040|SURE_RALSO 5'-nucleotidase SurE OS=Ralstonia solanacearum (strain GMI1000) GN=surE PE=3 SV=1 23 187 2.0E-08
sp|Q39VS1|SURE_GEOMG 5'-nucleotidase SurE OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=surE PE=3 SV=1 21 146 2.0E-08
sp|A0LHG0|SURE_SYNFM 5'-nucleotidase SurE OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=surE PE=3 SV=1 21 158 2.0E-08
sp|Q5WX53|SURE_LEGPL 5'-nucleotidase SurE OS=Legionella pneumophila (strain Lens) GN=surE PE=3 SV=1 21 146 2.0E-08
sp|Q5X5S5|SURE_LEGPA 5'-nucleotidase SurE OS=Legionella pneumophila (strain Paris) GN=surE PE=3 SV=1 21 146 2.0E-08
sp|A5IBD5|SURE_LEGPC 5'-nucleotidase SurE OS=Legionella pneumophila (strain Corby) GN=surE PE=3 SV=1 21 146 2.0E-08
sp|A3NA65|SURE_BURP6 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 668) GN=surE PE=3 SV=1 21 191 2.0E-08
sp|Q63UU4|SURE_BURPS 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain K96243) GN=surE PE=3 SV=1 21 191 2.0E-08
sp|Q3JRP0|SURE_BURP1 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1710b) GN=surE PE=3 SV=1 21 191 2.0E-08
sp|A3NVY2|SURE_BURP0 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1106a) GN=surE PE=3 SV=1 21 191 2.0E-08
sp|Q3MB98|SURE_ANAVT 5'-nucleotidase SurE OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=surE PE=3 SV=1 21 146 3.0E-08
sp|Q73G84|SURE_WOLPM 5'-nucleotidase SurE OS=Wolbachia pipientis wMel GN=surE PE=3 SV=1 23 146 3.0E-08
sp|Q10YV3|SURE_TRIEI 5'-nucleotidase SurE OS=Trichodesmium erythraeum (strain IMS101) GN=surE PE=3 SV=1 21 154 3.0E-08
sp|A1V4L3|SURE_BURMS 5'-nucleotidase SurE OS=Burkholderia mallei (strain SAVP1) GN=surE PE=3 SV=1 21 191 3.0E-08
sp|Q62JV2|SURE_BURMA 5'-nucleotidase SurE OS=Burkholderia mallei (strain ATCC 23344) GN=surE PE=3 SV=1 21 191 3.0E-08
sp|A2S290|SURE_BURM9 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10229) GN=surE PE=3 SV=1 21 191 3.0E-08
sp|A3MK87|SURE_BURM7 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10247) GN=surE PE=3 SV=1 21 191 3.0E-08
sp|Q3JCZ4|SURE_NITOC 5'-nucleotidase SurE OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=surE PE=3 SV=1 21 157 3.0E-08
sp|B9M4Z4|SURE_GEODF 5'-nucleotidase SurE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=surE PE=3 SV=1 21 146 3.0E-08
sp|B1WXT3|SURE_CYAA5 5'-nucleotidase SurE OS=Cyanothece sp. (strain ATCC 51142) GN=surE PE=3 SV=1 23 155 4.0E-08
sp|Q5N0F0|SURE_SYNP6 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=surE PE=3 SV=1 21 146 4.0E-08
sp|Q31LH6|SURE_SYNE7 5'-nucleotidase SurE OS=Synechococcus elongatus (strain PCC 7942) GN=surE PE=3 SV=1 21 146 4.0E-08
sp|C0R4G7|SURE_WOLWR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=surE PE=3 SV=1 23 146 4.0E-08
sp|Q0ANE1|SURE_MARMM 5'-nucleotidase SurE OS=Maricaulis maris (strain MCS10) GN=surE PE=3 SV=1 22 150 5.0E-08
sp|Q2LUH7|SURE_SYNAS 5'-nucleotidase SurE OS=Syntrophus aciditrophicus (strain SB) GN=surE PE=3 SV=1 21 146 5.0E-08
sp|Q5GS87|SURE_WOLTR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=surE PE=3 SV=1 23 146 6.0E-08
sp|C0ZGV3|SURE_BREBN 5'-nucleotidase SurE OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=surE PE=3 SV=1 21 146 6.0E-08
sp|B0SJM4|SURE_LEPBP 5'-nucleotidase SurE OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=surE PE=3 SV=1 23 146 7.0E-08
sp|B0SBG1|SURE_LEPBA 5'-nucleotidase SurE OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=surE PE=3 SV=1 23 146 7.0E-08
sp|C6BUG4|SURE_DESAD 5'-nucleotidase SurE OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=surE PE=3 SV=1 23 149 7.0E-08
sp|A8FK82|SURE_CAMJ8 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=surE PE=3 SV=1 21 172 7.0E-08
sp|Q5L5X3|SURE_CHLAB 5'-nucleotidase SurE OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=surE PE=3 SV=1 22 148 7.0E-08
sp|A6TRH0|SURE_ALKMQ 5'-nucleotidase SurE OS=Alkaliphilus metalliredigens (strain QYMF) GN=surE PE=3 SV=1 21 146 9.0E-08
sp|A7HXK5|SURE_PARL1 5'-nucleotidase SurE OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=surE PE=3 SV=1 17 159 9.0E-08
sp|A5V3Z0|SURE_SPHWW 5'-nucleotidase SurE OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=surE PE=3 SV=1 21 146 9.0E-08
sp|Q5HWH7|SURE_CAMJR 5'-nucleotidase SurE OS=Campylobacter jejuni (strain RM1221) GN=surE PE=3 SV=1 21 172 9.0E-08
sp|Q9PIK6|SURE_CAMJE 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=surE PE=3 SV=1 21 172 9.0E-08
sp|Q5GYL1|SURE_XANOR 5'-nucleotidase SurE OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=surE PE=3 SV=2 21 146 9.0E-08
sp|B2SUB2|SURE_XANOP 5'-nucleotidase SurE OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=surE PE=3 SV=1 21 146 9.0E-08
sp|Q2P1L4|SURE_XANOM 5'-nucleotidase SurE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=surE PE=3 SV=1 21 146 9.0E-08
sp|Q46ZH1|SURE_CUPPJ 5'-nucleotidase SurE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=surE PE=3 SV=1 23 170 9.0E-08
sp|A1VY14|SURE_CAMJJ 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=surE PE=3 SV=1 21 172 9.0E-08
sp|B3R1L4|SURE_CUPTR 5'-nucleotidase SurE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=surE PE=3 SV=1 23 146 9.0E-08
sp|A9GFF6|SURE_SORC5 5'-nucleotidase SurE OS=Sorangium cellulosum (strain So ce56) GN=surE PE=3 SV=1 23 146 9.0E-08
sp|Q9A6T5|SURE_CAUCR 5'-nucleotidase SurE OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=surE PE=3 SV=1 21 152 1.0E-07
sp|B8GX52|SURE_CAUCN 5'-nucleotidase SurE OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=surE PE=3 SV=1 21 152 1.0E-07
sp|Q2NVM2|SURE_SODGM 5'/3'-nucleotidase SurE OS=Sodalis glossinidius (strain morsitans) GN=surE PE=3 SV=1 23 146 1.0E-07
sp|Q15P28|SURE_PSEA6 5'-nucleotidase SurE OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=surE PE=3 SV=1 22 146 1.0E-07
sp|Q31G71|SURE_THICR 5'-nucleotidase SurE OS=Thiomicrospira crunogena (strain XCL-2) GN=surE PE=3 SV=1 21 146 1.0E-07
sp|Q3YSH3|SURE_EHRCJ 5'-nucleotidase SurE OS=Ehrlichia canis (strain Jake) GN=surE PE=3 SV=1 21 148 1.0E-07
sp|B0K177|SURE_THEPX 5'-nucleotidase SurE OS=Thermoanaerobacter sp. (strain X514) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|B0K9J0|SURE_THEP3 5'-nucleotidase SurE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|A8ZXL1|SURE_DESOH 5'-nucleotidase SurE OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|Q47D24|SURE_DECAR 5'-nucleotidase SurE OS=Dechloromonas aromatica (strain RCB) GN=surE PE=3 SV=1 21 181 2.0E-07
sp|Q0K950|SURE_CUPNH 5'-nucleotidase SurE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=surE PE=3 SV=1 23 146 2.0E-07
sp|C5BGI8|SURE_EDWI9 5'/3'-nucleotidase SurE OS=Edwardsiella ictaluri (strain 93-146) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|A5CVV1|SURE_VESOH 5'-nucleotidase SurE OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|B2VG26|SURE_ERWT9 5'/3'-nucleotidase SurE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|Q3IDD3|SURE_PSEHT 5'-nucleotidase SurE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=surE PE=3 SV=1 21 146 2.0E-07
sp|Q2W4A1|SURE_MAGSA 5'-nucleotidase SurE OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=surE PE=3 SV=1 22 146 2.0E-07
sp|C4LBQ6|SURE_TOLAT 5'-nucleotidase SurE OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=surE PE=3 SV=1 21 146 3.0E-07
sp|Q7NNG7|SURE_GLOVI 5'-nucleotidase SurE OS=Gloeobacter violaceus (strain PCC 7421) GN=surE PE=3 SV=1 21 146 3.0E-07
sp|Q823A6|SURE1_CHLCV 5'-nucleotidase SurE 1 OS=Chlamydophila caviae (strain GPIC) GN=surE1 PE=3 SV=1 22 148 3.0E-07
sp|Q74CZ6|SURE_GEOSL 5'-nucleotidase SurE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=surE PE=3 SV=1 21 146 3.0E-07
sp|Q87AK6|SURE_XYLFT 5'-nucleotidase SurE OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=surE PE=3 SV=1 21 146 4.0E-07
sp|B0U4U5|SURE_XYLFM 5'-nucleotidase SurE OS=Xylella fastidiosa (strain M12) GN=surE PE=3 SV=1 21 146 4.0E-07
sp|B2I8X7|SURE_XYLF2 5'-nucleotidase SurE OS=Xylella fastidiosa (strain M23) GN=surE PE=3 SV=1 21 146 4.0E-07
sp|B2A4J5|SURE_NATTJ 5'-nucleotidase SurE OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=surE PE=3 SV=1 21 157 4.0E-07
sp|B1I3V7|SURE_DESAP 5'-nucleotidase SurE OS=Desulforudis audaxviator (strain MP104C) GN=surE PE=3 SV=1 21 146 4.0E-07
sp|Q9PF20|SURE_XYLFA 5'-nucleotidase SurE OS=Xylella fastidiosa (strain 9a5c) GN=surE PE=1 SV=1 21 146 4.0E-07
sp|A9KDH9|SURE_COXBN 5'-nucleotidase SurE OS=Coxiella burnetii (strain Dugway 5J108-111) GN=surE PE=3 SV=1 18 157 4.0E-07
sp|A8F523|SURE_PSELT 5'-nucleotidase SurE OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=surE PE=3 SV=1 21 146 4.0E-07
sp|Q2SWF5|SURE_BURTA 5'-nucleotidase SurE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=surE PE=3 SV=1 21 191 4.0E-07
sp|Q57979|SURE_METJA 5'-nucleotidase SurE OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=surE PE=3 SV=2 21 181 4.0E-07
sp|A5D2G6|SURE_PELTS 5'-nucleotidase SurE OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=surE PE=3 SV=1 21 156 5.0E-07
sp|Q9KI21|SURE_COXBU 5'-nucleotidase SurE OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=surE PE=1 SV=1 18 157 5.0E-07
sp|A9N9U7|SURE_COXBR 5'-nucleotidase SurE OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=surE PE=3 SV=1 18 157 5.0E-07
sp|B6J3X6|SURE_COXB2 5'-nucleotidase SurE OS=Coxiella burnetii (strain CbuG_Q212) GN=surE PE=3 SV=1 18 157 5.0E-07
sp|B6J4X6|SURE_COXB1 5'-nucleotidase SurE OS=Coxiella burnetii (strain CbuK_Q154) GN=surE PE=3 SV=1 18 157 5.0E-07
sp|Q1J2E1|SURE_DEIGD 5'-nucleotidase SurE OS=Deinococcus geothermalis (strain DSM 11300) GN=surE PE=3 SV=1 22 156 5.0E-07
sp|Q1ATN8|SURE_RUBXD 5'-nucleotidase SurE OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=surE PE=3 SV=2 21 150 6.0E-07
sp|A4TQ00|SURE_YERPP 5'/3'-nucleotidase SurE OS=Yersinia pestis (strain Pestoides F) GN=surE PE=3 SV=1 22 146 6.0E-07
sp|Q1CLR3|SURE_YERPN 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=surE PE=3 SV=1 22 146 6.0E-07
sp|A9R116|SURE_YERPG 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=surE PE=3 SV=1 22 146 6.0E-07
sp|Q8ZBP9|SURE_YERPE 5'/3'-nucleotidase SurE OS=Yersinia pestis GN=surE PE=3 SV=1 22 146 6.0E-07
sp|Q1C475|SURE_YERPA 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=surE PE=3 SV=1 22 146 6.0E-07
sp|Q6LMT6|SURE_PHOPR 5'-nucleotidase SurE OS=Photobacterium profundum GN=surE PE=3 SV=2 21 146 6.0E-07
sp|B1LB13|SURE_THESQ 5'-nucleotidase SurE OS=Thermotoga sp. (strain RQ2) GN=surE PE=3 SV=1 21 146 7.0E-07
sp|Q87LQ5|SURE_VIBPA 5'-nucleotidase SurE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=surE PE=3 SV=1 16 146 7.0E-07
sp|Q7U5U4|SURE_SYNPX 5'-nucleotidase SurE OS=Synechococcus sp. (strain WH8102) GN=surE PE=3 SV=1 22 155 9.0E-07
sp|Q254M8|SURE_CHLFF 5'-nucleotidase SurE OS=Chlamydophila felis (strain Fe/C-56) GN=surE PE=3 SV=1 22 180 9.0E-07
sp|A8G9Z5|SURE_SERP5 5'/3'-nucleotidase SurE OS=Serratia proteamaculans (strain 568) GN=surE PE=3 SV=1 22 146 1.0E-06
sp|Q9KUI9|SURE_VIBCH 5'-nucleotidase SurE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=surE PE=3 SV=2 22 146 1.0E-06
sp|A5HYC6|SURE_CLOBH 5'-nucleotidase SurE OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=surE PE=3 SV=1 23 148 1.0E-06
sp|A7FQP3|SURE_CLOB1 5'-nucleotidase SurE OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=surE PE=3 SV=1 23 148 1.0E-06
sp|B0JX00|SURE_MICAN 5'-nucleotidase SurE OS=Microcystis aeruginosa (strain NIES-843) GN=surE PE=3 SV=1 22 146 1.0E-06
sp|C3LS21|SURE_VIBCM 5'-nucleotidase SurE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=surE PE=3 SV=1 22 146 1.0E-06
sp|A5F9D9|SURE_VIBC3 5'-nucleotidase SurE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=surE PE=3 SV=1 22 146 1.0E-06
sp|A6Q9V0|SURE_SULNB 5'-nucleotidase SurE OS=Sulfurovum sp. (strain NBC37-1) GN=surE PE=3 SV=1 21 146 1.0E-06
sp|A1JJT7|SURE_YERE8 5'/3'-nucleotidase SurE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=surE PE=3 SV=1 22 146 1.0E-06
sp|Q67NP4|SURE_SYMTH 5'-nucleotidase SurE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=surE PE=3 SV=1 23 146 1.0E-06
sp|Q1H096|SURE_METFK 5'-nucleotidase SurE OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=surE PE=3 SV=1 21 180 1.0E-06
sp|Q48F87|SURE_PSE14 5'-nucleotidase SurE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=surE PE=3 SV=1 21 146 2.0E-06
sp|B9K7G8|SURE_THENN 5'-nucleotidase SurE OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=surE PE=3 SV=1 21 149 2.0E-06
sp|A5ILS0|SURE_THEP1 5'-nucleotidase SurE OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=surE PE=3 SV=1 21 146 2.0E-06
sp|B9KI89|SURE_ANAMF 5'-nucleotidase SurE OS=Anaplasma marginale (strain Florida) GN=surE PE=3 SV=1 21 181 2.0E-06
sp|Q128R7|SURE_POLSJ 5'-nucleotidase SurE OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=surE PE=3 SV=1 22 146 2.0E-06
sp|B8ERC6|SURE_METSB 5'-nucleotidase SurE OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=surE PE=3 SV=1 21 162 2.0E-06
sp|A7I2X3|SURE_CAMHC 5'-nucleotidase SurE OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=surE PE=3 SV=1 21 149 2.0E-06
sp|Q487E6|SURE_COLP3 5'-nucleotidase SurE OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=surE PE=3 SV=2 21 146 2.0E-06
sp|Q5PB34|SURE_ANAMM 5'-nucleotidase SurE OS=Anaplasma marginale (strain St. Maries) GN=surE PE=3 SV=1 21 181 2.0E-06
sp|P96112|SURE_THEMA 5'-nucleotidase SurE OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=surE PE=1 SV=2 21 146 2.0E-06
sp|Q1QU76|SURE_CHRSD 5'-nucleotidase SurE OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=surE PE=3 SV=1 21 146 2.0E-06
sp|A2SQ45|SURE_METLZ 5'-nucleotidase SurE OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=surE PE=3 SV=1 22 191 2.0E-06
sp|A7MTT7|SURE_VIBCB 5'-nucleotidase SurE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=surE PE=3 SV=1 22 146 2.0E-06
sp|Q2NI97|SURE_METST 5'-nucleotidase SurE OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=surE PE=3 SV=1 21 148 2.0E-06
sp|O27484|SURE_METTH 5'-nucleotidase SurE OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=surE PE=3 SV=1 21 148 2.0E-06
sp|Q3SRQ5|SURE_NITWN 5'-nucleotidase SurE OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=surE PE=3 SV=1 21 148 2.0E-06
sp|A4YV68|SURE_BRASO 5'-nucleotidase SurE OS=Bradyrhizobium sp. (strain ORS278) GN=surE PE=3 SV=1 21 197 2.0E-06
sp|B9KDQ8|SURE_CAMLR 5'-nucleotidase SurE OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=surE PE=3 SV=1 21 146 2.0E-06
sp|Q9RRT8|SURE_DEIRA 5'-nucleotidase SurE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=surE PE=3 SV=1 88 146 2.0E-06
sp|A7I6S6|SURE_METB6 5'-nucleotidase SurE OS=Methanoregula boonei (strain 6A8) GN=surE PE=3 SV=1 23 186 2.0E-06
sp|B1JB30|SURE_PSEPW 5'-nucleotidase SurE OS=Pseudomonas putida (strain W619) GN=surE PE=3 SV=1 21 146 3.0E-06
sp|Q30QB8|SURE_SULDN 5'-nucleotidase SurE OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=surE PE=3 SV=1 22 180 3.0E-06
sp|B5BEY1|SURE_SALPK 5'/3'-nucleotidase SurE OS=Salmonella paratyphi A (strain AKU_12601) GN=surE PE=3 SV=1 21 146 3.0E-06
sp|Q5PEG4|SURE_SALPA 5'/3'-nucleotidase SurE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=surE PE=3 SV=1 21 146 3.0E-06
sp|A7HLM0|SURE_FERNB 5'-nucleotidase SurE OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=surE PE=3 SV=1 23 146 3.0E-06
sp|B1JJF5|SURE_YERPY 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=surE PE=3 SV=1 22 146 3.0E-06
sp|Q66EC0|SURE_YERPS 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=surE PE=3 SV=1 22 146 3.0E-06
sp|B2K580|SURE_YERPB 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=surE PE=3 SV=1 22 146 3.0E-06
sp|A7FLX5|SURE_YERP3 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=surE PE=3 SV=1 22 146 3.0E-06
sp|C3K705|SURE_PSEFS 5'-nucleotidase SurE OS=Pseudomonas fluorescens (strain SBW25) GN=surE PE=3 SV=1 21 146 3.0E-06
sp|A9MF31|SURE_SALAR 5'/3'-nucleotidase SurE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|A2SF75|SURE_METPP 5'-nucleotidase SurE OS=Methylibium petroleiphilum (strain PM1) GN=surE PE=3 SV=2 21 146 4.0E-06
sp|P66881|SURE_SALTY 5'/3'-nucleotidase SurE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=surE PE=1 SV=1 21 146 4.0E-06
sp|P66882|SURE_SALTI 5'/3'-nucleotidase SurE OS=Salmonella typhi GN=surE PE=3 SV=1 21 146 4.0E-06
sp|B4TTV8|SURE_SALSV 5'/3'-nucleotidase SurE OS=Salmonella schwarzengrund (strain CVM19633) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|B4T454|SURE_SALNS 5'/3'-nucleotidase SurE OS=Salmonella newport (strain SL254) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|B5RDQ0|SURE_SALG2 5'/3'-nucleotidase SurE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|B5QW15|SURE_SALEP 5'/3'-nucleotidase SurE OS=Salmonella enteritidis PT4 (strain P125109) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|Q57KJ7|SURE_SALCH 5'/3'-nucleotidase SurE OS=Salmonella choleraesuis (strain SC-B67) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|A9N2D0|SURE_SALPB 5'/3'-nucleotidase SurE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|A4G4J2|SURE_HERAR 5'-nucleotidase SurE OS=Herminiimonas arsenicoxydans GN=surE PE=3 SV=1 22 146 4.0E-06
sp|Q3INV7|SURE_NATPD 5'-nucleotidase SurE OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|A9BER9|SURE_PETMO 5'-nucleotidase SurE OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=surE PE=3 SV=1 23 146 4.0E-06
sp|Q8ZU79|SURE1_PYRAE 5'-nucleotidase SurE1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=surE1 PE=1 SV=1 21 146 4.0E-06
sp|B2IJG0|SURE_BEII9 5'-nucleotidase SurE OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=surE PE=3 SV=1 21 146 4.0E-06
sp|A8ANV8|SURE_CITK8 5'/3'-nucleotidase SurE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=surE PE=3 SV=1 21 146 5.0E-06
sp|A4J5D2|SURE_DESRM 5'-nucleotidase SurE OS=Desulfotomaculum reducens (strain MI-1) GN=surE PE=3 SV=1 21 146 5.0E-06
sp|Q7NRV1|SURE_CHRVO 5'-nucleotidase SurE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=surE PE=3 SV=1 21 151 5.0E-06
sp|Q82VV9|SURE_NITEU 5'-nucleotidase SurE OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=surE PE=3 SV=1 21 180 5.0E-06
sp|B5XV37|SURE_KLEP3 5'/3'-nucleotidase SurE OS=Klebsiella pneumoniae (strain 342) GN=surE PE=3 SV=1 21 146 6.0E-06
sp|Q9HQB2|SURE_HALSA 5'-nucleotidase SurE OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=surE PE=3 SV=1 22 146 6.0E-06
sp|B0R567|SURE_HALS3 5'-nucleotidase SurE OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=surE PE=3 SV=1 22 146 6.0E-06
sp|Q2RTH6|SURE_RHORT 5'-nucleotidase SurE OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=surE PE=3 SV=1 22 146 6.0E-06
sp|A4XWR2|SURE_PSEMY 5'-nucleotidase SurE OS=Pseudomonas mendocina (strain ymp) GN=surE PE=3 SV=1 21 146 6.0E-06
sp|Q07N44|SURE_RHOP5 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain BisA53) GN=surE PE=3 SV=1 21 148 6.0E-06
sp|A7MJ60|SURE_CROS8 5'/3'-nucleotidase SurE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=surE PE=3 SV=1 21 146 6.0E-06
sp|Q0IC13|SURE_SYNS3 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9311) GN=surE PE=3 SV=1 22 155 7.0E-06
sp|Q2NDM8|SURE_ERYLH 5'-nucleotidase SurE OS=Erythrobacter litoralis (strain HTCC2594) GN=surE PE=3 SV=1 21 146 7.0E-06
sp|A5N6V8|SURE_CLOK5 5'-nucleotidase SurE OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=surE PE=3 SV=1 21 146 7.0E-06
sp|B9E0C7|SURE_CLOK1 5'-nucleotidase SurE OS=Clostridium kluyveri (strain NBRC 12016) GN=surE PE=3 SV=1 21 146 7.0E-06
sp|A5EJV7|SURE_BRASB 5'-nucleotidase SurE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=surE PE=3 SV=1 21 183 7.0E-06
sp|Q136H7|SURE_RHOPS 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain BisB5) GN=surE PE=3 SV=1 21 148 7.0E-06
sp|Q7VN28|SURE_HAEDU 5'-nucleotidase SurE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=surE PE=3 SV=1 21 146 8.0E-06
sp|C1FQW9|SURE_CLOBJ 5'-nucleotidase SurE OS=Clostridium botulinum (strain Kyoto / Type A2) GN=surE PE=3 SV=1 23 148 8.0E-06
sp|Q1QME1|SURE_NITHX 5'-nucleotidase SurE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=surE PE=3 SV=1 21 148 8.0E-06
sp|Q65Q81|SURE_MANSM 5'-nucleotidase SurE OS=Mannheimia succiniciproducens (strain MBEL55E) GN=surE PE=3 SV=2 21 146 8.0E-06
sp|A9IP06|SURE_BORPD 5'-nucleotidase SurE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=surE PE=3 SV=1 21 146 8.0E-06
sp|B0BTK8|SURE_ACTPJ 5'-nucleotidase SurE OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=surE PE=3 SV=1 21 146 8.0E-06
sp|B3H2Z8|SURE_ACTP7 5'-nucleotidase SurE OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=surE PE=3 SV=1 21 146 8.0E-06
sp|A3N3M1|SURE_ACTP2 5'-nucleotidase SurE OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=surE PE=3 SV=1 21 146 8.0E-06
sp|Q4ZWQ0|SURE_PSEU2 5'-nucleotidase SurE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=surE PE=3 SV=1 21 146 8.0E-06
sp|B4RDI0|SURE_PHEZH 5'-nucleotidase SurE OS=Phenylobacterium zucineum (strain HLK1) GN=surE PE=3 SV=1 21 152 8.0E-06
sp|Q7VXN2|SURE_BORPE 5'-nucleotidase SurE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=surE PE=3 SV=1 21 146 9.0E-06
sp|A5EY39|SURE_DICNV 5'-nucleotidase SurE OS=Dichelobacter nodosus (strain VCS1703A) GN=surE PE=3 SV=1 23 146 9.0E-06
sp|Q3ZXG5|SURE_DEHMC 5'-nucleotidase SurE OS=Dehalococcoides mccartyi (strain CBDB1) GN=surE PE=3 SV=1 22 146 9.0E-06
sp|A6VUV4|SURE_MARMS 5'-nucleotidase SurE OS=Marinomonas sp. (strain MWYL1) GN=surE PE=3 SV=1 21 146 9.0E-06
sp|B7KB74|SURE_CYAP7 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7424) GN=surE PE=3 SV=1 23 155 9.0E-06
sp|B0T1Q2|SURE_CAUSK 5'-nucleotidase SurE OS=Caulobacter sp. (strain K31) GN=surE PE=3 SV=1 22 146 1.0E-05
sp|P73440|Y1459_SYNY3 Putative 5'-nucleotidase alr3139 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1459 PE=3 SV=1 23 146 1.0E-05
sp|Q0ADP1|SURE_NITEC 5'-nucleotidase SurE OS=Nitrosomonas eutropha (strain C91) GN=surE PE=3 SV=1 21 181 1.0E-05
sp|A6LL96|SURE_THEM4 5'-nucleotidase SurE OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=surE PE=3 SV=1 23 146 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|037620
MKASFVKLLALTTLICGTAAQKIVLANDDGWATANIREEYKELVAAGFEVILSAPPVDRSGTGRSTATPTPMNVT
CEFDTCAVGSPAIDTDPHDRNIHYVHAFPNPDFVVAGVNIGRKLGPTVHISGTDSAACEAANLGIPSFAFSGQSG
SFVSFTTLETDHKGQSTIDAKIYTALVRKFLSAYLAGHSSLQDSYKSSGHSSGHSSDHSSGCSSGHSSGHSSGHS
PDHSSGHSSHHSSDPSRLVPAGTTVNINFSATSSCNNNADNFKFIATKSFPDTPGGDTERCGSRQLPLEQTVSDA
GCFATVSVINSTTEDNALAAEQKAVFDRAHTLLTCM*
Coding >Agabi119p4|037620
ATGAAGGCCTCTTTCGTCAAGCTTCTCGCTCTCACCACTCTCATATGCGGTACGGCCGCTCAAAAGATTGTGCTC
GCCAATGATGACGGCTGGGCGACCGCCAATATCCGTGAAGAGTACAAGGAACTCGTGGCAGCAGGTTTCGAGGTC
ATTCTCTCTGCGCCCCCCGTGGACAGGTCTGGCACTGGAAGGAGCACAGCGACACCTACGCCTATGAATGTAACT
TGCGAGTTCGACACCTGTGCTGTCGGTTCTCCGGCCATTGATACAGACCCCCATGATCGAAACATTCACTATGTC
CACGCGTTCCCGAATCCCGACTTTGTCGTCGCTGGCGTTAACATCGGCCGTAAGTTGGGCCCCACTGTTCACATC
TCTGGCACTGATAGCGCCGCTTGCGAGGCTGCAAACTTGGGGATTCCCTCTTTCGCTTTTTCTGGCCAATCTGGT
TCATTTGTCTCTTTTACGACTCTCGAAACCGACCACAAAGGCCAATCCACCATCGACGCTAAAATATACACGGCG
CTCGTTCGGAAATTCCTTTCTGCGTACCTTGCAGGCCATTCTTCCCTCCAAGATTCCTACAAATCTTCCGGCCAT
TCTTCTGGCCATTCTTCCGATCATTCTTCTGGCTGTTCTTCTGGCCATTCTTCTGGCCATTCTTCTGGTCATTCT
CCCGACCATTCTTCCGGCCATTCTTCCCATCATTCTTCCGACCCTTCCCGTCTTGTGCCCGCAGGAACCACTGTC
AATATCAATTTCAGTGCTACGAGCAGTTGCAATAATAACGCAGATAACTTCAAATTCATTGCTACCAAATCATTC
CCTGATACGCCAGGTGGTGATACGGAGAGGTGTGGGTCACGTCAACTTCCCCTTGAGCAGACCGTGTCAGATGCG
GGTTGTTTCGCGACCGTGAGTGTGATTAACTCGACGACGGAAGACAATGCGTTGGCCGCGGAGCAAAAGGCGGTC
TTCGATAGGGCGCACACGTTGTTGACTTGTATGTAG
Transcript >Agabi119p4|037620
ATGAAGGCCTCTTTCGTCAAGCTTCTCGCTCTCACCACTCTCATATGCGGTACGGCCGCTCAAAAGATTGTGCTC
GCCAATGATGACGGCTGGGCGACCGCCAATATCCGTGAAGAGTACAAGGAACTCGTGGCAGCAGGTTTCGAGGTC
ATTCTCTCTGCGCCCCCCGTGGACAGGTCTGGCACTGGAAGGAGCACAGCGACACCTACGCCTATGAATGTAACT
TGCGAGTTCGACACCTGTGCTGTCGGTTCTCCGGCCATTGATACAGACCCCCATGATCGAAACATTCACTATGTC
CACGCGTTCCCGAATCCCGACTTTGTCGTCGCTGGCGTTAACATCGGCCGTAAGTTGGGCCCCACTGTTCACATC
TCTGGCACTGATAGCGCCGCTTGCGAGGCTGCAAACTTGGGGATTCCCTCTTTCGCTTTTTCTGGCCAATCTGGT
TCATTTGTCTCTTTTACGACTCTCGAAACCGACCACAAAGGCCAATCCACCATCGACGCTAAAATATACACGGCG
CTCGTTCGGAAATTCCTTTCTGCGTACCTTGCAGGCCATTCTTCCCTCCAAGATTCCTACAAATCTTCCGGCCAT
TCTTCTGGCCATTCTTCCGATCATTCTTCTGGCTGTTCTTCTGGCCATTCTTCTGGCCATTCTTCTGGTCATTCT
CCCGACCATTCTTCCGGCCATTCTTCCCATCATTCTTCCGACCCTTCCCGTCTTGTGCCCGCAGGAACCACTGTC
AATATCAATTTCAGTGCTACGAGCAGTTGCAATAATAACGCAGATAACTTCAAATTCATTGCTACCAAATCATTC
CCTGATACGCCAGGTGGTGATACGGAGAGGTGTGGGTCACGTCAACTTCCCCTTGAGCAGACCGTGTCAGATGCG
GGTTGTTTCGCGACCGTGAGTGTGATTAACTCGACGACGGAAGACAATGCGTTGGCCGCGGAGCAAAAGGCGGTC
TTCGATAGGGCGCACACGTTGTTGACTTGTATGTAG
Gene >Agabi119p4|037620
ATGAAGGCCTCTTTCGTCAAGCTTCTCGCTCTCACCACTCTCATATGCGGTACGGCCGCTCAAAAGATTGTGCTC
GCCAATGATGACGGCTGGGCGACCGCCAATATCCGTGAAGAGTACAAGGAACTCGTGGCAGCAGGTTTCGAGGTG
AATATCGCTCTTGACCATGAGGCATCTTAATGTTCATTCAAAATTGATAATTGTTAGGTCATTCTCTCTGCGCCC
CCCGTGGACAGGTCTGGCACTGGAAGGAGCACAGCGACACCTACGCCTATGAATGTAACTTGCGAGTTCGACACC
TGTGCTGTCGGTTCTCCGGCCATTGATACAGACCCCCATGATCGTAAGTTCTAGTTCTTCCTGACATGGATATAT
CTAATGTTCAACAACAGGAAACATTCACTATGTCCACGCGTTCCCGTATGTTCATTAATGTGAACATATATGCGC
AAGGTTGATATTCTCTATTTTGATTTTAACGCCGACGCCGTTCGCGTTGGTATTCAAGATCTCGCTAAAGCTCGT
TGGGGTAGGAATCCCGACTTTGTCGTCGCTGGCGTTAACATCGGCCGTACGTACACAAACTGAATTTCACGAGTG
CAATAATGAACGCATCCTTTTCTAGGTAAGTTGGGCCCCACTGTTCACATCTCTGGCACTGAGTAAGTTACACAT
GTATCTCTTCTTTGCAATGGCTCTTACTTATTCTTATATTACAGTAGCGCCGCTTGCGAGGCTGCAAACTTGGGG
ATTCCCTCTTTCGCTTTTTCTGGCCAATCTGGTTCATTTGTCTCTTTTACGACTCTCGAAACCGACCACAAAGGC
CAATCCACCATCGACGCTAAAATATACACGGCGCTCGTTCGGAAATTCCTTTCTGCGTACCTTGCAGGCCATTCT
TCCCTCCAAGATTCCTACAAATCTTCCGGCCATTCTTCTGGCCATTCTTCCGATCATTCTTCTGGCTGTTCTTCT
GGCCATTCTTCTGGCCATTCTTCTGGTCATTCTCCCGACCATTCTTCCGGCCATTCTTCCCATCATTCTTCCGAC
CCTTCCCGTCTTGTGCCCGCAGGAACCACTGTCAATATCAATTTCAGTGCTACGAGCAGTTGCAATAATAACGCA
GATAACTTCAAATTCATTGCTACCAAATCATTCCCTGATACGCCAGGTGGTGATACGGAGAGGTGTGGGTCACGT
CAACTTCCCCTTGAGCAGACCGTGTCAGATGCGGGTTGTTTCGCGACCGTGAGTGTGATTAACTCGACGACGGAA
GACAATGCGTTGGCCGCGGAGCAAAAGGCGGTCTTCGATAGGGCGCACACGTTGTTGACTTGTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail