Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|037140
Gene name
Locationscaffold_13:937438..939892
Strand+
Gene length (bp)2454
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 2.4E-261 50 655
PF06723 MreB_Mbl MreB/Mbl protein 4.1E-17 181 416

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 5 675 0.0E+00
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 10 668 0.0E+00
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 17 675 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 5 675 0.0E+00
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 10 668 0.0E+00
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 17 675 0.0E+00
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 10 675 0.0E+00
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 41 675 0.0E+00
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 10 654 0.0E+00
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 17 675 0.0E+00
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 41 675 0.0E+00
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 17 675 0.0E+00
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 36 675 0.0E+00
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 41 675 0.0E+00
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 41 675 0.0E+00
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 48 662 0.0E+00
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 41 675 0.0E+00
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 23 662 0.0E+00
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 41 675 0.0E+00
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 41 675 0.0E+00
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 10 675 0.0E+00
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 12 675 0.0E+00
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 21 675 0.0E+00
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 42 656 0.0E+00
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 24 675 0.0E+00
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 20 664 0.0E+00
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 17 655 0.0E+00
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 17 663 0.0E+00
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 30 658 0.0E+00
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 16 659 0.0E+00
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 21 655 0.0E+00
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 18 675 0.0E+00
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 20 675 0.0E+00
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 21 675 0.0E+00
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 17 675 0.0E+00
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 21 655 0.0E+00
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 21 655 0.0E+00
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 9 655 0.0E+00
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 51 655 0.0E+00
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 48 665 0.0E+00
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 51 655 0.0E+00
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 48 667 0.0E+00
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 51 654 0.0E+00
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 48 663 0.0E+00
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 46 675 0.0E+00
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 48 663 0.0E+00
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 51 654 0.0E+00
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 48 663 0.0E+00
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 49 661 0.0E+00
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 48 663 0.0E+00
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 48 663 0.0E+00
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 51 668 0.0E+00
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 48 663 0.0E+00
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 48 655 0.0E+00
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 51 654 0.0E+00
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 48 667 0.0E+00
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 48 655 0.0E+00
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 48 655 0.0E+00
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 48 655 0.0E+00
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 48 655 0.0E+00
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 48 655 0.0E+00
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 48 655 0.0E+00
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 48 665 0.0E+00
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 48 660 0.0E+00
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 48 655 0.0E+00
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 48 655 0.0E+00
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 51 655 0.0E+00
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 51 664 0.0E+00
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 49 654 0.0E+00
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 51 654 0.0E+00
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 48 655 0.0E+00
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 51 654 0.0E+00
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 48 654 0.0E+00
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 51 655 0.0E+00
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 49 654 0.0E+00
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 51 659 0.0E+00
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 48 667 0.0E+00
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 48 654 0.0E+00
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 48 654 0.0E+00
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 48 654 0.0E+00
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 51 654 0.0E+00
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 51 654 0.0E+00
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 49 654 0.0E+00
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 49 655 0.0E+00
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 51 654 0.0E+00
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 48 655 0.0E+00
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 49 654 0.0E+00
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 49 654 0.0E+00
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 51 654 0.0E+00
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 48 655 0.0E+00
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 48 655 0.0E+00
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 48 655 0.0E+00
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 48 655 0.0E+00
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 48 655 0.0E+00
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 49 654 0.0E+00
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 48 655 0.0E+00
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 48 655 0.0E+00
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 45 655 0.0E+00
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 49 654 0.0E+00
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 51 651 0.0E+00
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 51 655 0.0E+00
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 48 655 0.0E+00
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 45 655 0.0E+00
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 48 657 0.0E+00
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 48 655 0.0E+00
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 23 675 0.0E+00
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 48 656 0.0E+00
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 51 655 0.0E+00
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 51 654 0.0E+00
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 49 655 0.0E+00
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 51 659 0.0E+00
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 51 651 0.0E+00
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 51 664 0.0E+00
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 51 656 0.0E+00
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 49 663 0.0E+00
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 51 662 0.0E+00
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 48 655 0.0E+00
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 51 663 0.0E+00
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 51 654 0.0E+00
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 49 655 0.0E+00
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 47 655 0.0E+00
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 51 654 0.0E+00
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 49 662 0.0E+00
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 49 662 0.0E+00
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 51 656 0.0E+00
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 51 654 0.0E+00
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 47 655 0.0E+00
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 48 657 0.0E+00
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 51 654 0.0E+00
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 51 663 0.0E+00
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 51 655 0.0E+00
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 51 655 0.0E+00
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 51 654 0.0E+00
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 51 655 0.0E+00
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 48 655 0.0E+00
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 51 655 0.0E+00
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 51 655 0.0E+00
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 48 657 0.0E+00
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 51 655 0.0E+00
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 49 662 0.0E+00
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 51 655 0.0E+00
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 48 665 0.0E+00
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 47 655 0.0E+00
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 46 654 0.0E+00
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 51 658 0.0E+00
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 47 655 0.0E+00
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 48 658 0.0E+00
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 51 655 0.0E+00
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 48 655 0.0E+00
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 48 656 0.0E+00
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 48 662 0.0E+00
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 48 654 0.0E+00
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 48 655 0.0E+00
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 51 655 0.0E+00
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 48 658 0.0E+00
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 51 656 0.0E+00
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 51 654 0.0E+00
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 47 554 0.0E+00
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 51 654 0.0E+00
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 47 637 0.0E+00
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 47 629 0.0E+00
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 47 646 0.0E+00
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 47 612 0.0E+00
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 47 630 0.0E+00
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 47 612 0.0E+00
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 47 596 0.0E+00
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 47 596 0.0E+00
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 47 630 0.0E+00
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 47 639 0.0E+00
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 50 616 0.0E+00
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 50 616 0.0E+00
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 50 616 0.0E+00
sp|Q54BD8|HS7C4_DICDI Heat shock cognate 70 kDa protein 4 OS=Dictyostelium discoideum GN=DDB_G0293678 PE=3 SV=1 51 564 0.0E+00
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 50 616 0.0E+00
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 50 642 0.0E+00
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 47 671 0.0E+00
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q5NPS6|DNAK_ZYMMO Chaperone protein DnaK OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaK PE=3 SV=1 48 655 0.0E+00
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 50 659 0.0E+00
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 50 667 0.0E+00
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 50 656 0.0E+00
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 50 629 0.0E+00
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 48 675 0.0E+00
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 48 624 0.0E+00
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 50 625 0.0E+00
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 50 625 0.0E+00
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 50 609 0.0E+00
sp|Q92260|HSP70_PENCI Heat shock 70 kDa protein (Fragment) OS=Penicillium citrinum GN=HSP70 PE=1 SV=1 177 649 0.0E+00
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 50 588 0.0E+00
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q52701|DNAK_RHOCA Chaperone protein DnaK OS=Rhodobacter capsulatus GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 49 657 0.0E+00
sp|B2IBR4|DNAK_BEII9 Chaperone protein DnaK OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaK PE=3 SV=1 48 626 0.0E+00
sp|B8EIP9|DNAK_METSB Chaperone protein DnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=3 SV=1 50 616 0.0E+00
sp|A8GR22|DNAK_RICRS Chaperone protein DnaK OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|B0BWH1|DNAK_RICRO Chaperone protein DnaK OS=Rickettsia rickettsii (strain Iowa) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|B4S6P7|DNAK_PROA2 Chaperone protein DnaK OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaK PE=3 SV=1 47 661 0.0E+00
sp|Q28VY3|DNAK_JANSC Chaperone protein DnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=3 SV=1 50 621 0.0E+00
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 48 619 0.0E+00
sp|B1LZ51|DNAK_METRJ Chaperone protein DnaK OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|A9W6R7|DNAK_METEP Chaperone protein DnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|Q5PAB8|DNAK_ANAMM Chaperone protein DnaK OS=Anaplasma marginale (strain St. Maries) GN=dnaK PE=3 SV=1 50 632 0.0E+00
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|B7KSZ4|DNAK_METC4 Chaperone protein DnaK OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q5HAY1|DNAK_EHRRW Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q5FFM4|DNAK_EHRRG Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Gardel) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 47 660 0.0E+00
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 48 616 0.0E+00
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 47 621 0.0E+00
sp|Q1QRU1|DNAK_NITHX Chaperone protein DnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|B3EKT9|DNAK_CHLPB Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain BS1) GN=dnaK PE=3 SV=1 47 662 0.0E+00
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 48 661 0.0E+00
sp|B1ZGR1|DNAK_METPB Chaperone protein DnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=3 SV=1 48 635 0.0E+00
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 48 666 0.0E+00
sp|Q1RHH0|DNAK_RICBR Chaperone protein DnaK OS=Rickettsia bellii (strain RML369-C) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|Q2G6N0|DNAK_NOVAD Chaperone protein DnaK OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|B8DRD6|DNAK_DESVM Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 47 664 0.0E+00
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 48 660 0.0E+00
sp|C3PMM7|DNAK_RICAE Chaperone protein DnaK OS=Rickettsia africae (strain ESF-5) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|P61443|DNAK_LEPIN Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaK PE=3 SV=1 50 664 0.0E+00
sp|Q2J320|DNAK_RHOP2 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=3 SV=1 47 626 0.0E+00
sp|Q68XI2|DNAK_RICTY Chaperone protein DnaK OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaK PE=3 SV=1 48 624 0.0E+00
sp|Q4UJK7|DNAK_RICFE Chaperone protein DnaK OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaK PE=3 SV=2 48 624 0.0E+00
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|B6IVA4|DNAK_RHOCS Chaperone protein DnaK OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|Q4FNP9|DNAK_PELUB Chaperone protein DnaK OS=Pelagibacter ubique (strain HTCC1062) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 48 588 0.0E+00
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 48 588 0.0E+00
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 47 665 0.0E+00
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 48 658 0.0E+00
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 48 588 0.0E+00
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 48 641 0.0E+00
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 50 618 0.0E+00
sp|A8GMF9|DNAK_RICAH Chaperone protein DnaK OS=Rickettsia akari (strain Hartford) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q07US6|DNAK_RHOP5 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q2VYT1|DNAK_MAGSA Chaperone protein DnaK OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaK PE=3 SV=1 50 588 0.0E+00
sp|Q0BWZ9|DNAK_HYPNA Chaperone protein DnaK OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|B8J402|DNAK_DESDA Chaperone protein DnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 16 655 0.0E+00
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 16 655 0.0E+00
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 48 588 0.0E+00
sp|Q73Q16|DNAK_TREDE Chaperone protein DnaK OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|P61442|DNAK_LEPIC Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q04Y47|DNAK_LEPBL Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaK PE=3 SV=1 50 662 0.0E+00
sp|Q04VC8|DNAK_LEPBJ Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaK PE=3 SV=1 50 662 0.0E+00
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 50 669 0.0E+00
sp|Q01PM8|DNAK_SOLUE Chaperone protein DnaK OS=Solibacter usitatus (strain Ellin6076) GN=dnaK PE=3 SV=1 48 591 0.0E+00
sp|Q92J36|DNAK_RICCN Chaperone protein DnaK OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaK PE=3 SV=1 48 609 0.0E+00
sp|Q21CI2|DNAK_RHOPB Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q4FPS9|DNAK_PSYA2 Chaperone protein DnaK OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|C4K110|DNAK_RICPU Chaperone protein DnaK OS=Rickettsia peacockii (strain Rustic) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|Q13E60|DNAK_RHOPS Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 48 656 0.0E+00
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 47 664 0.0E+00
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 48 588 0.0E+00
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 51 661 0.0E+00
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 48 588 0.0E+00
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 50 674 0.0E+00
sp|Q85FW4|DNAK_CYAME Chaperone protein dnaK OS=Cyanidioschyzon merolae GN=dnaK PE=3 SV=1 50 647 0.0E+00
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 50 596 0.0E+00
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A6VNB1|DNAK_ACTSZ Chaperone protein DnaK OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 47 612 0.0E+00
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 50 618 0.0E+00
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 48 588 0.0E+00
sp|Q3SIN4|DNAK_THIDA Chaperone protein DnaK OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 50 642 0.0E+00
sp|Q1Q7X0|DNAK_PSYCK Chaperone protein DnaK OS=Psychrobacter cryohalolentis (strain K5) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A1VFG6|DNAK_DESVV Chaperone protein DnaK OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaK PE=3 SV=1 48 662 0.0E+00
sp|Q72DW8|DNAK_DESVH Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaK PE=3 SV=1 48 662 0.0E+00
sp|P94317|DNAK_BRADU Chaperone protein DnaK OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q8YW74|DNAK2_NOSS1 Chaperone protein dnaK2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK2 PE=3 SV=1 50 623 0.0E+00
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 50 672 0.0E+00
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|Q65U55|DNAK_MANSM Chaperone protein DnaK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaK PE=3 SV=2 47 654 0.0E+00
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1 43 649 0.0E+00
sp|Q5FSL5|DNAK_GLUOX Chaperone protein DnaK OS=Gluconobacter oxydans (strain 621H) GN=dnaK PE=3 SV=1 50 609 0.0E+00
sp|A4JBS1|DNAK_BURVG Chaperone protein DnaK OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 48 642 0.0E+00
sp|B0UWR4|DNAK_HISS2 Chaperone protein DnaK OS=Histophilus somni (strain 2336) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q0I3V2|DNAK_HAES1 Chaperone protein DnaK OS=Haemophilus somnus (strain 129Pt) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 50 621 0.0E+00
sp|B5RPM1|DNAK_BORRA Chaperone protein DnaK OS=Borrelia recurrentis (strain A1) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q7W519|DNAK_BORPA Chaperone protein DnaK OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|A9HEA3|DNAK_GLUDA Chaperone protein DnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=3 SV=1 50 609 0.0E+00
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 48 661 0.0E+00
sp|B3QZ38|DNAK_CHLT3 Chaperone protein DnaK OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=dnaK PE=3 SV=1 47 633 0.0E+00
sp|Q7VVY2|DNAK_BORPE Chaperone protein DnaK OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|B5RM75|DNAK_BORDL Chaperone protein DnaK OS=Borrelia duttonii (strain Ly) GN=dnaK PE=3 SV=1 48 662 0.0E+00
sp|Q7WGI4|DNAK_BORBR Chaperone protein DnaK OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 47 664 0.0E+00
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 48 625 0.0E+00
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 47 644 0.0E+00
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 50 669 0.0E+00
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 47 675 0.0E+00
sp|A9IGC3|DNAK_BORPD Chaperone protein DnaK OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|Q1CV46|DNAK_HELPH Chaperone protein DnaK OS=Helicobacter pylori (strain HPAG1) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|O68191|DNAK_BURPS Chaperone protein DnaK OS=Burkholderia pseudomallei (strain K96243) GN=dnaK PE=3 SV=2 48 654 0.0E+00
sp|A3ND68|DNAK_BURP6 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 668) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A3NYX7|DNAK_BURP0 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1106a) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A1V0U6|DNAK_BURMS Chaperone protein DnaK OS=Burkholderia mallei (strain SAVP1) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q62HD5|DNAK_BURMA Chaperone protein DnaK OS=Burkholderia mallei (strain ATCC 23344) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A2S565|DNAK_BURM9 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10229) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A3MN99|DNAK_BURM7 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10247) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q0SMZ0|DNAK_BORAP Chaperone protein DnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|B6JPL0|DNAK_HELP2 Chaperone protein DnaK OS=Helicobacter pylori (strain P12) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q3JP10|DNAK_BURP1 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1710b) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A9AGB8|DNAK_BURM1 Chaperone protein DnaK OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A4J7F3|DNAK_DESRM Chaperone protein DnaK OS=Desulfotomaculum reducens (strain MI-1) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 48 660 0.0E+00
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 50 666 0.0E+00
sp|B7J282|DNAK_BORBZ Chaperone protein DnaK OS=Borrelia burgdorferi (strain ZS7) GN=dnaK PE=2 SV=1 48 625 0.0E+00
sp|P0C922|DNAK_BORBU Chaperone protein DnaK OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaK PE=2 SV=1 48 625 0.0E+00
sp|Q2Y6U0|DNAK_NITMU Chaperone protein DnaK OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dnaK PE=3 SV=1 47 666 0.0E+00
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 47 641 0.0E+00
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q39JC8|DNAK_BURL3 Chaperone protein DnaK OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q661A3|DNAK_BORBP Chaperone protein DnaK OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaK PE=3 SV=1 48 625 0.0E+00
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A6QBG0|DNAK_SULNB Chaperone protein DnaK OS=Sulfurovum sp. (strain NBC37-1) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|A4G8D2|DNAK_HERAR Chaperone protein DnaK OS=Herminiimonas arsenicoxydans GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|Q0BI18|DNAK_BURCM Chaperone protein DnaK OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|B4EDZ2|DNAK_BURCJ Chaperone protein DnaK OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|B1YTK0|DNAK_BURA4 Chaperone protein DnaK OS=Burkholderia ambifaria (strain MC40-6) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 47 666 0.0E+00
sp|B2UKV6|DNAK_AKKM8 Chaperone protein DnaK OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=dnaK PE=3 SV=1 50 639 0.0E+00
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|P0C937|DNAK_PORGI Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|B3CNB5|DNAK_WOLPP Chaperone protein DnaK OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B5Z9P0|DNAK_HELPG Chaperone protein DnaK OS=Helicobacter pylori (strain G27) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 47 658 0.0E+00
sp|Q2SYZ4|DNAK_BURTA Chaperone protein DnaK OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|B2S0M0|DNAK_BORHD Chaperone protein DnaK OS=Borrelia hermsii (strain HS1 / DAH) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|C4XQ63|DNAK_DESMR Chaperone protein DnaK OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=dnaK PE=3 SV=1 48 641 0.0E+00
sp|A5FPU4|DNAK_DEHMB Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dnaK PE=3 SV=1 47 671 0.0E+00
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 47 634 0.0E+00
sp|Q2RNE6|DNAK_RHORT Chaperone protein DnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q3Z6P1|DNAK_DEHM1 Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dnaK PE=3 SV=1 50 598 0.0E+00
sp|A0K4S8|DNAK_BURCH Chaperone protein DnaK OS=Burkholderia cenocepacia (strain HI2424) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|B1JW19|DNAK_BURCC Chaperone protein DnaK OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q1BYX3|DNAK_BURCA Chaperone protein DnaK OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 50 672 0.0E+00
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 50 664 0.0E+00
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 47 655 0.0E+00
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 50 672 0.0E+00
sp|Q2KWA2|DNAK_BORA1 Chaperone protein DnaK OS=Bordetella avium (strain 197N) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|B5ENA3|DNAK_ACIF5 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|B7J7X9|DNAK_ACIF2 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1 43 596 0.0E+00
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|C6BSF2|DNAK_DESAD Chaperone protein DnaK OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaK PE=3 SV=1 50 664 0.0E+00
sp|B2JGE2|DNAK_BURP8 Chaperone protein DnaK OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|C0R3W7|DNAK_WOLWR Chaperone protein DnaK OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|B2RJ90|DNAK_PORG3 Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|Q3ZYV1|DNAK_DEHMC Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain CBDB1) GN=dnaK PE=3 SV=1 47 671 0.0E+00
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A1K4C5|DNAK_AZOSB Chaperone protein DnaK OS=Azoarcus sp. (strain BH72) GN=dnaK PE=3 SV=1 47 640 0.0E+00
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 43 655 0.0E+00
sp|O33528|DNAK_RHILE Chaperone protein DnaK OS=Rhizobium leguminosarum GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q88DU2|DNAK_PSEPK Chaperone protein DnaK OS=Pseudomonas putida (strain KT2440) GN=dnaK PE=3 SV=1 47 675 0.0E+00
sp|A1ANV0|DNAK_PELPD Chaperone protein DnaK OS=Pelobacter propionicus (strain DSM 2379) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|B9L8Z0|DNAK_NAUPA Chaperone protein DnaK OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|A1WAR6|DNAK_ACISJ Chaperone protein DnaK OS=Acidovorax sp. (strain JS42) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q73GL7|DNAK_WOLPM Chaperone protein DnaK OS=Wolbachia pipientis wMel GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|A1WGJ9|DNAK_VEREI Chaperone protein DnaK OS=Verminephrobacter eiseniae (strain EF01-2) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|Q46XI7|DNAK_CUPPJ Chaperone protein DnaK OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A4SQ25|DNAK_AERS4 Chaperone protein DnaK OS=Aeromonas salmonicida (strain A449) GN=dnaK PE=3 SV=1 47 618 0.0E+00
sp|A0KMI6|DNAK_AERHH Chaperone protein DnaK OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|A6LDG8|DNAK_PARD8 Chaperone protein DnaK OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 50 664 0.0E+00
sp|B3R6G7|DNAK_CUPTR Chaperone protein DnaK OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaK PE=3 SV=1 48 618 0.0E+00
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|Q145F1|DNAK_BURXL Chaperone protein DnaK OS=Burkholderia xenovorans (strain LB400) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q9KD72|DNAK_BACHD Chaperone protein DnaK OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaK PE=3 SV=3 50 655 0.0E+00
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 48 643 0.0E+00
sp|A8Z5V5|DNAK_SULMW Chaperone protein DnaK OS=Sulcia muelleri (strain GWSS) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q0K757|DNAK_CUPNH Chaperone protein DnaK OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=3 SV=1 47 618 0.0E+00
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 50 675 0.0E+00
sp|P71331|DNAK_AGGAC Chaperone protein DnaK OS=Aggregatibacter actinomycetemcomitans GN=dnaK PE=3 SV=3 47 618 0.0E+00
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|A1TLH9|DNAK_ACIAC Chaperone protein DnaK OS=Acidovorax citrulli (strain AAC00-1) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q0AKB1|DNAK_MARMM Chaperone protein DnaK OS=Maricaulis maris (strain MCS10) GN=dnaK PE=3 SV=1 50 621 0.0E+00
sp|Q11QH3|DNAK_CYTH3 Chaperone protein DnaK OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|B3PF33|DNAK_CELJU Chaperone protein DnaK OS=Cellvibrio japonicus (strain Ueda107) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 50 664 0.0E+00
sp|Q0HY11|DNAK_SHESR Chaperone protein DnaK OS=Shewanella sp. (strain MR-7) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q0HLN0|DNAK_SHESM Chaperone protein DnaK OS=Shewanella sp. (strain MR-4) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A5W9A3|DNAK_PSEP1 Chaperone protein DnaK OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaK PE=3 SV=1 47 662 0.0E+00
sp|Q607A5|DNAK_METCA Chaperone protein DnaK OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 50 641 0.0E+00
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|B2SXC6|DNAK_BURPP Chaperone protein DnaK OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q3IC08|DNAK_PSEHT Chaperone protein DnaK OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaK PE=3 SV=1 47 616 0.0E+00
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 47 616 0.0E+00
sp|Q6MB26|DNAK_PARUW Chaperone protein DnaK OS=Protochlamydia amoebophila (strain UWE25) GN=dnaK PE=3 SV=1 42 647 0.0E+00
sp|B1Y786|DNAK_LEPCP Chaperone protein DnaK OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A6T226|DNAK_JANMA Chaperone protein DnaK OS=Janthinobacterium sp. (strain Marseille) GN=dnaK PE=3 SV=1 48 610 0.0E+00
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|B4S0U1|DNAK_ALTMD Chaperone protein DnaK OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dnaK PE=3 SV=1 47 616 0.0E+00
sp|A1JJD5|DNAK_YERE8 Chaperone protein DnaK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaK PE=3 SV=1 47 673 0.0E+00
sp|A0KTS5|DNAK_SHESA Chaperone protein DnaK OS=Shewanella sp. (strain ANA-3) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|C0QGP6|DNAK_DESAH Chaperone protein DnaK OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|B3DZP7|DNAK_METI4 Chaperone protein DnaK OS=Methylacidiphilum infernorum (isolate V4) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A6W2D2|DNAK_MARMS Chaperone protein DnaK OS=Marinomonas sp. (strain MWYL1) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A9BNG5|DNAK_DELAS Chaperone protein DnaK OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 50 588 0.0E+00
sp|O52960|DNAK_APHHA Chaperone protein DnaK OS=Aphanothece halophytica GN=dnaK PE=2 SV=1 48 600 0.0E+00
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 47 596 0.0E+00
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q1AXX6|DNAK_RUBXD Chaperone protein DnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|C5B7L7|DNAK_EDWI9 Chaperone protein DnaK OS=Edwardsiella ictaluri (strain 93-146) GN=dnaK PE=3 SV=1 47 647 0.0E+00
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 47 672 0.0E+00
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 47 672 0.0E+00
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 47 672 0.0E+00
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 50 630 0.0E+00
sp|A9VHU1|DNAK_BACWK Chaperone protein DnaK OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q83MH5|DNAK_SHIFL Chaperone protein DnaK OS=Shigella flexneri GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q0T8H6|DNAK_SHIF8 Chaperone protein DnaK OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|A5WI20|DNAK_PSYWF Chaperone protein DnaK OS=Psychrobacter sp. (strain PRwf-1) GN=dnaK PE=3 SV=1 51 654 0.0E+00
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A3M8W9|DNAK_ACIBT Chaperone protein DnaK OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaK PE=3 SV=2 50 671 0.0E+00
sp|B2HZZ7|DNAK_ACIBC Chaperone protein DnaK OS=Acinetobacter baumannii (strain ACICU) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|B2S2G4|DNAK_TREPS Chaperone protein DnaK OS=Treponema pallidum subsp. pallidum (strain SS14) GN=dnaK PE=3 SV=1 48 674 0.0E+00
sp|O83246|DNAK_TREPA Chaperone protein DnaK OS=Treponema pallidum (strain Nichols) GN=dnaK PE=3 SV=1 48 674 0.0E+00
sp|A1STE4|DNAK_PSYIN Chaperone protein DnaK OS=Psychromonas ingrahamii (strain 37) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|P69377|DNAK_PORUM Chaperone protein dnaK OS=Porphyra umbilicalis GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|P69376|DNAK_PORPU Chaperone protein dnaK OS=Porphyra purpurea GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B9MDJ7|DNAK_ACIET Chaperone protein DnaK OS=Acidovorax ebreus (strain TPSY) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|P22774|HSP7M_SCHPO Heat shock 70 kDa protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=2 SV=2 39 674 0.0E+00
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 50 654 0.0E+00
sp|Q5GSE1|DNAK_WOLTR Chaperone protein DnaK OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 47 596 0.0E+00
sp|Q5F6W5|DNAK_NEIG1 Chaperone protein DnaK OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|B0TAD7|DNAK_HELMI Chaperone protein DnaK OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A4XYF6|DNAK_PSEMY Chaperone protein DnaK OS=Pseudomonas mendocina (strain ymp) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 50 655 0.0E+00
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q634M7|DNAK_BACCZ Chaperone protein DnaK OS=Bacillus cereus (strain ZK / E33L) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q818E9|DNAK_BACCR Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B7HCU0|DNAK_BACC4 Chaperone protein DnaK OS=Bacillus cereus (strain B4264) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|C1ESK8|DNAK_BACC3 Chaperone protein DnaK OS=Bacillus cereus (strain 03BB102) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B7JN39|DNAK_BACC0 Chaperone protein DnaK OS=Bacillus cereus (strain AH820) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q81LS2|DNAK_BACAN Chaperone protein DnaK OS=Bacillus anthracis GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A0RIT3|DNAK_BACAH Chaperone protein DnaK OS=Bacillus thuringiensis (strain Al Hakam) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|C3L5R7|DNAK_BACAC Chaperone protein DnaK OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|C3P8M0|DNAK_BACAA Chaperone protein DnaK OS=Bacillus anthracis (strain A0248) GN=dnaK PE=3 SV=1 50 654 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0044183 protein folding chaperone No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 16 38 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|037140
MSPSVRHPTRTQSRTLLSSLSILFLAALAVLCFFPVAVNAEETHPEYGSVIGIDLGTTYSCVGVQRGGRVEIIAN
DQGHRITPSWVSFTDDERLVGDSAKNAYHSNPQNTVFDAKRLIGRKMNEPEVKRDMKHWPFKVTEKNGKPSISVE
HKGEERHFSAEEISAMVLGKMKETAEAYLGHKVTHAVITVPAYFNDAQRQATKDAGTIAGLHVLRIINEPTAAAI
AYGLNKGSGESQIIVYDLGGGTFDVSLLSIDDGVFEVLATAGDTHLGGEDFDNRVIDYFVKSYKKKTGTDVSKNL
RALGKLKREVEKAKRTLSSQQSTRIEIESFEDGNDFSETLTRAKFDELNMDLFRKTMKPVEQVLKDANVKKDEID
EVVLVGGSTRIPKVQQLLKEFFNGKEPSKGINPDEAVAYGAAVQGGILSGAEGTDGVVLVDVNPLTLGIETTGGV
FTKLIPRNTVIPTKKSQIFSTAADNQPTVLIQVFEGERSLTKDNNLLGKFELNGIPPAPRGVPQIEVTFEMDANG
IMKVSAADKGTGKSEGITIKNEKGRLSQEEIDRMVADAEKFAAEDEANRKKIEALNSLSSFVYGLKNQVTDSEGL
GGKLDSDDKQTILDAVKEATEWIEENGSTASVEDLEEKLAEVQGVVNPITTKLYEGAGADGPSGDDDFEFEHDEL
*
Coding >Agabi119p4|037140
ATGTCTCCCTCTGTCCGTCATCCGACGCGCACACAGAGCAGGACTCTCCTCTCTTCCCTCTCCATTCTTTTCCTC
GCTGCCCTCGCTGTCCTCTGCTTCTTCCCCGTCGCTGTAAATGCAGAAGAGACACATCCGGAGTACGGCAGTGTC
ATCGGTATTGATCTTGGTACAACTTATTCGTGTGTTGGTGTACAACGTGGCGGTCGTGTGGAAATCATTGCCAAC
GATCAAGGTCATCGAATTACTCCATCATGGGTCAGCTTCACGGACGATGAACGACTTGTCGGTGACTCCGCGAAA
AATGCCTACCACTCCAATCCCCAAAACACCGTATTTGATGCGAAGCGTCTCATTGGTCGCAAGATGAATGAACCG
GAAGTCAAACGCGACATGAAGCACTGGCCATTCAAGGTTACCGAGAAGAACGGCAAGCCCTCGATTTCCGTCGAA
CACAAGGGCGAAGAGCGTCACTTCTCCGCTGAGGAAATCTCCGCTATGGTTCTGGGCAAGATGAAGGAGACCGCT
GAGGCTTATCTCGGCCACAAGGTCACCCACGCAGTCATTACTGTCCCTGCTTACTTCAACGACGCTCAGCGTCAA
GCTACTAAGGATGCCGGAACTATTGCTGGCCTCCACGTCCTCCGTATTATTAACGAGCCCACTGCTGCCGCTATC
GCCTACGGTCTCAACAAGGGGAGTGGAGAATCTCAAATCATTGTCTACGATCTCGGTGGTGGTACTTTCGATGTG
TCACTCCTATCTATCGATGATGGTGTCTTCGAGGTTTTGGCTACCGCTGGTGACACTCACCTTGGTGGTGAAGAT
TTCGACAACCGTGTCATCGACTACTTTGTCAAGTCGTACAAGAAGAAGACCGGTACCGATGTCAGCAAGAACCTT
CGTGCTCTCGGCAAACTGAAGCGTGAGGTTGAGAAGGCCAAGAGGACTCTCTCCAGTCAACAATCCACCCGTATT
GAAATCGAGTCGTTTGAGGATGGTAACGACTTCTCCGAGACCCTCACTCGTGCCAAATTCGACGAACTCAACATG
GATCTCTTCCGTAAGACCATGAAGCCCGTCGAGCAGGTGCTCAAGGACGCTAACGTTAAGAAGGATGAAATTGAC
GAGGTTGTTCTAGTTGGTGGCTCTACTCGTATCCCCAAGGTTCAGCAACTCCTCAAGGAGTTCTTCAACGGCAAG
GAACCCTCCAAGGGAATCAACCCCGATGAGGCTGTTGCTTATGGTGCCGCCGTCCAAGGTGGTATTCTTTCCGGC
GCTGAGGGAACAGACGGTGTCGTTCTTGTCGATGTCAACCCGCTCACTCTCGGTATCGAGACCACTGGTGGTGTC
TTCACGAAGCTCATTCCCCGTAACACCGTCATCCCCACGAAGAAGAGTCAAATCTTCTCTACCGCCGCCGACAAC
CAGCCTACCGTTCTTATTCAAGTCTTTGAGGGTGAACGTTCTCTTACCAAGGACAACAACCTCCTCGGCAAGTTC
GAACTCAATGGTATTCCTCCTGCTCCCCGCGGTGTTCCCCAAATCGAAGTCACTTTCGAGATGGATGCCAATGGT
ATCATGAAGGTCTCTGCCGCTGACAAGGGAACTGGCAAGTCTGAGGGTATCACCATCAAGAACGAGAAGGGCCGT
CTTTCTCAGGAGGAAATTGATCGCATGGTCGCCGACGCTGAGAAGTTCGCCGCTGAGGATGAGGCCAATCGCAAG
AAGATTGAGGCTCTTAACTCCCTCTCGTCCTTTGTGTACGGTCTCAAGAACCAGGTCACTGACTCTGAGGGACTT
GGTGGCAAACTCGATAGCGATGACAAGCAGACTATTTTGGATGCCGTCAAGGAAGCTACTGAGTGGATTGAGGAG
AACGGTTCCACTGCCAGTGTTGAGGACCTTGAAGAGAAGTTGGCCGAGGTCCAAGGTGTTGTTAACCCCATCACG
ACGAAACTCTATGAAGGCGCTGGTGCCGATGGTCCCTCTGGCGACGACGACTTTGAGTTTGAACACGATGAACTG
TAA
Transcript >Agabi119p4|037140
ATGTCTCCCTCTGTCCGTCATCCGACGCGCACACAGAGCAGGACTCTCCTCTCTTCCCTCTCCATTCTTTTCCTC
GCTGCCCTCGCTGTCCTCTGCTTCTTCCCCGTCGCTGTAAATGCAGAAGAGACACATCCGGAGTACGGCAGTGTC
ATCGGTATTGATCTTGGTACAACTTATTCGTGTGTTGGTGTACAACGTGGCGGTCGTGTGGAAATCATTGCCAAC
GATCAAGGTCATCGAATTACTCCATCATGGGTCAGCTTCACGGACGATGAACGACTTGTCGGTGACTCCGCGAAA
AATGCCTACCACTCCAATCCCCAAAACACCGTATTTGATGCGAAGCGTCTCATTGGTCGCAAGATGAATGAACCG
GAAGTCAAACGCGACATGAAGCACTGGCCATTCAAGGTTACCGAGAAGAACGGCAAGCCCTCGATTTCCGTCGAA
CACAAGGGCGAAGAGCGTCACTTCTCCGCTGAGGAAATCTCCGCTATGGTTCTGGGCAAGATGAAGGAGACCGCT
GAGGCTTATCTCGGCCACAAGGTCACCCACGCAGTCATTACTGTCCCTGCTTACTTCAACGACGCTCAGCGTCAA
GCTACTAAGGATGCCGGAACTATTGCTGGCCTCCACGTCCTCCGTATTATTAACGAGCCCACTGCTGCCGCTATC
GCCTACGGTCTCAACAAGGGGAGTGGAGAATCTCAAATCATTGTCTACGATCTCGGTGGTGGTACTTTCGATGTG
TCACTCCTATCTATCGATGATGGTGTCTTCGAGGTTTTGGCTACCGCTGGTGACACTCACCTTGGTGGTGAAGAT
TTCGACAACCGTGTCATCGACTACTTTGTCAAGTCGTACAAGAAGAAGACCGGTACCGATGTCAGCAAGAACCTT
CGTGCTCTCGGCAAACTGAAGCGTGAGGTTGAGAAGGCCAAGAGGACTCTCTCCAGTCAACAATCCACCCGTATT
GAAATCGAGTCGTTTGAGGATGGTAACGACTTCTCCGAGACCCTCACTCGTGCCAAATTCGACGAACTCAACATG
GATCTCTTCCGTAAGACCATGAAGCCCGTCGAGCAGGTGCTCAAGGACGCTAACGTTAAGAAGGATGAAATTGAC
GAGGTTGTTCTAGTTGGTGGCTCTACTCGTATCCCCAAGGTTCAGCAACTCCTCAAGGAGTTCTTCAACGGCAAG
GAACCCTCCAAGGGAATCAACCCCGATGAGGCTGTTGCTTATGGTGCCGCCGTCCAAGGTGGTATTCTTTCCGGC
GCTGAGGGAACAGACGGTGTCGTTCTTGTCGATGTCAACCCGCTCACTCTCGGTATCGAGACCACTGGTGGTGTC
TTCACGAAGCTCATTCCCCGTAACACCGTCATCCCCACGAAGAAGAGTCAAATCTTCTCTACCGCCGCCGACAAC
CAGCCTACCGTTCTTATTCAAGTCTTTGAGGGTGAACGTTCTCTTACCAAGGACAACAACCTCCTCGGCAAGTTC
GAACTCAATGGTATTCCTCCTGCTCCCCGCGGTGTTCCCCAAATCGAAGTCACTTTCGAGATGGATGCCAATGGT
ATCATGAAGGTCTCTGCCGCTGACAAGGGAACTGGCAAGTCTGAGGGTATCACCATCAAGAACGAGAAGGGCCGT
CTTTCTCAGGAGGAAATTGATCGCATGGTCGCCGACGCTGAGAAGTTCGCCGCTGAGGATGAGGCCAATCGCAAG
AAGATTGAGGCTCTTAACTCCCTCTCGTCCTTTGTGTACGGTCTCAAGAACCAGGTCACTGACTCTGAGGGACTT
GGTGGCAAACTCGATAGCGATGACAAGCAGACTATTTTGGATGCCGTCAAGGAAGCTACTGAGTGGATTGAGGAG
AACGGTTCCACTGCCAGTGTTGAGGACCTTGAAGAGAAGTTGGCCGAGGTCCAAGGTGTTGTTAACCCCATCACG
ACGAAACTCTATGAAGGCGCTGGTGCCGATGGTCCCTCTGGCGACGACGACTTTGAGTTTGAACACGATGAACTG
TAA
Gene >Agabi119p4|037140
ATGTCTCCCTCTGTCCGTCATCCGACGCGCACACAGAGCAGGACTCTCCTCTCTTCCCTCTCCATTCTTTTCCTC
GCTGCCCTCGCTGTCCTCTGCTTCTTCCCCGTCGCTGTAAATGCAGAAGAGACACATCCGGAGTACGGCAGTGTC
ATCGGTATTGGTACGTGTCCCCCCACTTCAGAAAGTGTGCAACACATCCTGACATGGTTCCCCTAGATCTTGGTA
CAACGTATGTGACTGGACTCGCCTCGCCTTGTTAATTTGACTGACTTGAAATGGTATCCAGTTATTCGTGTGTTG
GGTACGTGGCATTTTCACCTCGGCTATCTTAAGCATTGACATTTCCCAAAGTGTACAACGTGGCGGTCGTGTGGA
AATCATTGCCAACGATCAAGGTCATCGAATTACTCCATCATGGGTCAGCTTCACGGACGATGAACGACTGTGAGT
GCGCTTGGGCCCGGCGGTGATTTTATTTACTAAGAATTTGCAGTGTCGGTGACTCCGCGAAAAATGCCTACCACT
CCAATCCCCAAAACACCGTATTTGATGCGAAGCGTCTCATTGGTCGCAAGATGAATGAACCGGAAGTCAAACGCG
ACATGAAGCACTGGCCATTCAAGGTTACCGAGAAGAACGGCAAGCCCTCGATTTCCGTCGAACACAAGGGCGAAG
AGCGTCACTTCTCCGCTGAGGAAATCTCCGCTATGGTTCTGGGCAAGATGAAGGAGACCGCTGAGGCTTATCTCG
GCCACAAGGTCACCCACGCAGTCATTACTGTCCCTGCTTGTAAGCTCTCAGTGTTCTTCTCGTATATTTTAACTT
TCCTTAATGCTTATGATTAGACTTCAACGACGCTCAGCGTCAAGCTACTAAGGATGCCGGAACTATTGCTGGCCT
CCACGTCCTCCGTATTATTAACGAGCCCACTGCTGCCGCTATCGCCTACGGTCTCAACAAGGGGAGTGGAGAATC
TCAAATCATTGTCTACGATCTCGGTGGTGGTACTTTCGATGTGTCACTCCTATCTATCGATGATGGTGTCTTCGA
GGTTTTGGCTACCGCTGGTGACACTCACCTTGGTGGTGAAGATTTCGACAACCGTGTCATCGACTACTTTGTCAA
GTCGTACAAGAAGAAGACCGGTACCGATGTCAGCAAGAACCTTCGTGCTCTCGGCAAACTGAAGCGTGAGGTTGA
GAAGGCCAAGAGGACTCTCTCCAGTCAACAATCCACCCGTATTGAAATCGAGTCGTTTGAGGATGGTAACGACTT
CTCCGAGACCCTCACTCGTGCCAAATTCGACGAACTCAACATGGATCTCTTCCGTAAGACCATGAAGCCCGTCGA
GCAGGTGCTCAAGGACGCTAACGTTAAGAAGGATGAAATTGACGAGGTTCGTATTGTTTTAATTATCCGAGGAGC
ACCTTGCTCATTATCTCCAAAGGTTGTTCTAGTTGGTGGCTCTACTCGTATCCCCAAGGTTCAGCAACTCCTCAA
GGAGTTCTTCAACGGCAAGGAACCCTCCAAGGGAATCAACCCCGATGAGGCTGTTGCTTATGGTGCCGCCGTCCA
AGGTGGTATTCTTTCCGGCGCTGAGGGAACAGACGGTGTCGTTCTTGTCGATGTCAACCCGCTCACTCTCGGTAT
CGAGACCACTGGTGGTGTCTTCACGAAGCTCATTCCCCGTAACACCGTCATCCCCACGAAGAAGAGTCAAATCTT
CTCTACCGCCGCCGACAACCAGCCTACCGTTCTTATTCAAGTCTTTGAGGGTGAACGTTCTCTTACCAAGGACAA
CAACCTCCTCGGCAAGTTCGAACTCAATGGTATTCCTCCTGCTCCCCGCGGTGTTCCCCAAATCGAAGTCACTTT
CGAGATGGATGCCAATGGTATCATGAAGGTCTCTGCCGCTGACAAGGGAACGTAAGTACAATTCATATACATCCC
TTAGGTCTCATTCTGATTGTCTCGATAGTGGCAAGTCTGAGGGTATCACCATCAAGAACGAGAAGGGCCGTCTTT
CTCAGGAGGAAATTGATCGCATGGTCGCCGACGCTGAGAAGTTCGCCGCTGAGGATGAGGCCAATCGCAAGAAGA
TTGAGGCTCTTAACTCCCTCTCGTCCTTTGTGTACGGTCTCAAGAACCAGGTCACTGACTCTGAGGGACTTGGTG
GCAAACTCGATAGCGATGACAAGCAGACTATTTTGGATGCCGTCAAGGAAGCTACTGAGTGGATTGAGGAGAACG
GTTCCACTGCCAGTGTTGAGGACCTTGAAGAGAAGTTGGCCGGTACGTAACGCTCTTTCCTTCGTGCTTTTTTCT
CCTTTACTAATTCCTTTTTCAGAGGTCCAAGGTGTTGTTAACCCCATCACGACGAAACTCTATGAAGGCGCTGGT
GCCGATGGTCCCTCTGGCGACGACGACTTTGAGTTTGAACACGATGAACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail