Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|036330
Gene name
Locationscaffold_13:735481..736288
Strand+
Gene length (bp)807
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02586 SRAP SOS response associated peptidase (SRAP) 1.9E-55 1 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04471|YM04_YEAST Putative peptidase YMR114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR114C PE=1 SV=1 1 188 6.0E-33
sp|O64131|YOQW_BPSPB Putative SOS response-associated peptidase yoqW OS=Bacillus phage SPbeta GN=yoqW PE=3 SV=1 1 167 2.0E-25
sp|O31916|YOQW_BACSU Putative SOS response-associated peptidase YoqW OS=Bacillus subtilis (strain 168) GN=yoqW PE=3 SV=1 1 167 2.0E-25
sp|Q5ZJT1|HMCES_CHICK Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Gallus gallus GN=HMCES PE=2 SV=1 1 171 8.0E-23
sp|Q6P7N4|HMCES_XENTR Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Xenopus tropicalis GN=hmces PE=2 SV=1 1 125 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04471|YM04_YEAST Putative peptidase YMR114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR114C PE=1 SV=1 1 188 6.0E-33
sp|O64131|YOQW_BPSPB Putative SOS response-associated peptidase yoqW OS=Bacillus phage SPbeta GN=yoqW PE=3 SV=1 1 167 2.0E-25
sp|O31916|YOQW_BACSU Putative SOS response-associated peptidase YoqW OS=Bacillus subtilis (strain 168) GN=yoqW PE=3 SV=1 1 167 2.0E-25
sp|Q5ZJT1|HMCES_CHICK Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Gallus gallus GN=HMCES PE=2 SV=1 1 171 8.0E-23
sp|Q6P7N4|HMCES_XENTR Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Xenopus tropicalis GN=hmces PE=2 SV=1 1 125 4.0E-22
sp|O34915|YOBE_BACSU Putative SOS response-associated peptidase YobE OS=Bacillus subtilis (strain 168) GN=yobE PE=3 SV=1 1 167 2.0E-21
sp|O34906|YOAM_BACSU Putative SOS response-associated peptidase YoaM OS=Bacillus subtilis (strain 168) GN=yoaM PE=3 SV=1 1 167 3.0E-21
sp|Q96FZ2|HMCES_HUMAN Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Homo sapiens GN=HMCES PE=1 SV=1 1 213 5.0E-19
sp|Q6IND6|HMCES_XENLA Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Xenopus laevis GN=hmces PE=2 SV=1 1 125 9.0E-19
sp|Q8R1M0|HMCES_MOUSE Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Mus musculus GN=Hmces PE=1 SV=1 1 125 1.0E-18
sp|Q5NVR0|HMCES_PONAB Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Pongo abelii GN=HMCES PE=2 SV=1 1 213 1.0E-18
sp|Q5XIJ1|HMCES_RAT Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein OS=Rattus norvegicus GN=Hmces PE=2 SV=1 1 125 2.0E-18
sp|P76318|YEDK_ECOLI Putative SOS response-associated peptidase YedK OS=Escherichia coli (strain K12) GN=yedK PE=1 SV=2 3 169 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0003697 single-stranded DNA binding Yes
GO:0018142 protein-DNA covalent cross-linking Yes
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0003676 nucleic acid binding No
GO:0050896 response to stimulus No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0006950 response to stress No
GO:0018143 nucleic acid-protein covalent cross-linking No
GO:0044238 primary metabolic process No
GO:0033554 cellular response to stress No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0003677 DNA binding No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|036330
MKWGLVPHWSTHENKSLSTTNARADTLVDNSSMWARLRATKRCVVPCQGYYEWLNRGKQKLPHFTKRKDSNIMLL
AGLYDSAVIEGQTLWTFTIVTTDANKEFSWLHDRQPVILSSQQAVSQWLDQPWSKQLAALLEPYHDPDVPLECYQ
VPQEVGKVGTESPSFIEPVALRKDGIQAMFQKQRQSQKRARTPSPVPSPKESSSPKKKQKTKPITAFFPKK*
Coding >Agabi119p4|036330
ATGAAATGGGGCCTCGTTCCCCACTGGAGCACCCACGAAAACAAGTCCCTCAGCACCACCAACGCCCGCGCCGAC
ACCCTCGTCGACAACAGCAGCATGTGGGCTCGTCTCCGTGCCACCAAGCGCTGCGTTGTGCCCTGTCAAGGCTAC
TACGAATGGCTCAACCGAGGCAAGCAAAAGCTTCCCCACTTTACCAAGCGCAAAGACAGCAACATCATGCTTCTC
GCTGGTCTCTACGACTCGGCCGTCATCGAAGGCCAAACTCTCTGGACCTTTACTATTGTCACTACCGATGCTAAT
AAAGAGTTCTCTTGGCTCCATGATCGCCAGCCCGTCATTCTGTCCTCACAACAGGCCGTCAGCCAGTGGCTTGAC
CAGCCGTGGTCAAAGCAACTCGCAGCTCTCCTCGAACCTTACCATGACCCAGATGTGCCTCTGGAATGCTACCAA
GTCCCTCAAGAAGTCGGCAAAGTCGGCACAGAGTCTCCCTCTTTTATCGAGCCTGTTGCCCTCCGCAAGGACGGT
ATACAAGCCATGTTTCAAAAGCAGAGACAGTCTCAGAAACGTGCCAGAACACCCTCTCCCGTACCATCTCCGAAA
GAGTCGTCCTCACCCAAGAAAAAGCAGAAAACAAAACCTATAACCGCCTTCTTTCCAAAAAAGTAG
Transcript >Agabi119p4|036330
ATGAAATGGGGCCTCGTTCCCCACTGGAGCACCCACGAAAACAAGTCCCTCAGCACCACCAACGCCCGCGCCGAC
ACCCTCGTCGACAACAGCAGCATGTGGGCTCGTCTCCGTGCCACCAAGCGCTGCGTTGTGCCCTGTCAAGGCTAC
TACGAATGGCTCAACCGAGGCAAGCAAAAGCTTCCCCACTTTACCAAGCGCAAAGACAGCAACATCATGCTTCTC
GCTGGTCTCTACGACTCGGCCGTCATCGAAGGCCAAACTCTCTGGACCTTTACTATTGTCACTACCGATGCTAAT
AAAGAGTTCTCTTGGCTCCATGATCGCCAGCCCGTCATTCTGTCCTCACAACAGGCCGTCAGCCAGTGGCTTGAC
CAGCCGTGGTCAAAGCAACTCGCAGCTCTCCTCGAACCTTACCATGACCCAGATGTGCCTCTGGAATGCTACCAA
GTCCCTCAAGAAGTCGGCAAAGTCGGCACAGAGTCTCCCTCTTTTATCGAGCCTGTTGCCCTCCGCAAGGACGGT
ATACAAGCCATGTTTCAAAAGCAGAGACAGTCTCAGAAACGTGCCAGAACACCCTCTCCCGTACCATCTCCGAAA
GAGTCGTCCTCACCCAAGAAAAAGCAGAAAACAAAACCTATAACCGCCTTCTTTCCAAAAAAGTAG
Gene >Agabi119p4|036330
ATGAAATGGGGCCTCGTTCCCCACTGGAGCACCCACGAAAACAAGTCCCTCAGCACCACCAACGCCCGCGCCGAC
ACCCTCGTCGACAACAGCAGCATGTGGGCTCGTCTCCGTGCCACCAAGCGCTGCGTTGTGCCCTGTCAAGGGTAT
GTGTCTCGCTTCTCTTGCCTACAACGTCTCAACTACCACAGCTACTACGAATGGCTCAACCGAGGCAAGCAAAAG
CTTCCCCACTTTACCAAGCGCAAAGACAGCAACATCATGCTTCTCGCTGGTCTCTACGACTCGGCCGTCATCGAA
GGTTCAGACTTGTCTCTAGCTTTTATAATATCTGATACCCTTCCAGGCCAAACTCTCTGGACCTTTACTATTGTC
ACTACCGATGCTAATAAAGAGTTCTCTTGGCTCCATGATCGCCAGCCCGTCATTCTGTCCTCACAACAGGCCGTC
AGCCAGTGGCTTGACCAGCCGTGGTCAAAGCAACTCGCAGCTCTCCTCGAACCTTACCATGACCCAGATGTGCCT
CTGGAATGCTACCAAGTCCCTCAAGAAGTCGGCAAAGTCGGCACAGAGTCTCCCTCTTTTATCGAGCCTGTTGCC
CTCCGCAAGGACGGTATACAAGCCATGTTTCAAAAGCAGAGACAGTCTCAGAAACGTGCCAGAACACCCTCTCCC
GTACCATCTCCGAAAGAGTCGTCCTCACCCAAGAAAAAGCAGGTTTGTACACCCCTCAGCCTACCTTCACCCAGC
AACTAAACCCGAGTTAAGAAAACAAAACCTATAACCGCCTTCTTTCCAAAAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail