Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|036320
Gene name
Locationscaffold_13:733561..735276
Strand-
Gene length (bp)1715
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07524 Bromo_TP Bromodomain associated 3.6E-07 4 75

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Bromodomain transcription factor

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup2876
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|036320
Agaricus bisporus var bisporus H97 AgabiH97|036320
Agaricus bisporus var burnettii H119p4 Agabi119p4|036320 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|036320
MESAATKLVHAAAVKTLHAYNFSRSSSTAAITLSDLLARYLALLSESCAKYARHAGRTNLSVYDAVAVLDELGIG
MDELADFCASEAKELNRYASNSVRRIEDLHEFRAHLSTGLKQDNDDAIPLQFQIYHGDDDSEDEDVDMEPPPMPV
DARKTPPLSHPSPPLPLSPVSNPSSPSRKRPRTASWKPPPHIPAFLPPFPTIEPPPSRPPSPHETETQPAELMPP
PPDKPAVVSQAMTAPTASDYLAQVPYSQSSLSSIPEWHLPTPPKSFKSPPRKNALPTLQSEPALFKAYHHILTHP
PPSTPPPTNLSRHKVAMAFLSQTQNMPRWDAADTVFSTIAPCPPRVATIGPTYPVAINDPVNGKLDSKDKEFRFP
PTIPRPVSTTERLTPLLGQQSHRIPELARHVLPPVVMSRTTRLVHPPVLNRGSKPVLYGRGIPAPWNSHAIPPTD
GTNNPPPTPVATSTKDKIRENGETPTKSHIPDAQLFATWDFETKDYKLPLPLSHRQHRTRVASLTSGQNSVNLGT
ASRPKSGPPKHG*
Coding >Agabi119p4|036320
ATGGAGTCTGCAGCCACAAAACTCGTCCACGCCGCCGCCGTCAAGACGCTGCACGCCTACAACTTTTCGCGCTCG
TCGTCCACCGCAGCGATCACCCTCTCCGACCTCCTCGCACGCTACCTCGCCCTTCTCTCAGAGTCGTGCGCCAAA
TACGCTCGTCATGCAGGCAGGACCAATCTCTCCGTGTACGATGCTGTTGCCGTTCTCGACGAACTGGGTATTGGT
ATGGACGAGCTTGCCGACTTTTGTGCTAGTGAGGCCAAGGAGCTCAATCGCTATGCGTCCAATTCTGTTCGGCGG
ATAGAAGACCTTCACGAGTTTAGAGCACATCTCTCTACCGGTCTCAAGCAGGATAATGACGACGCGATCCCACTG
CAATTTCAGATCTACCACGGCGACGACGACAGCGAGGACGAGGACGTAGACATGGAACCGCCCCCGATGCCCGTC
GACGCCCGAAAGACGCCGCCGCTCTCTCATCCGTCGCCGCCGCTTCCCCTTTCGCCCGTCTCCAATCCCTCCTCT
CCCTCCCGCAAACGCCCTCGCACAGCCAGCTGGAAACCCCCGCCTCACATCCCCGCCTTTCTTCCTCCTTTCCCC
ACCATCGAACCCCCGCCAAGCAGGCCACCGTCGCCCCACGAAACCGAGACACAGCCCGCAGAACTCATGCCACCC
CCGCCCGATAAACCTGCCGTCGTTTCTCAAGCCATGACCGCCCCTACAGCCTCCGACTATCTCGCCCAGGTTCCC
TATTCTCAATCCTCTCTTTCTTCGATACCAGAATGGCATCTACCCACTCCTCCAAAATCCTTCAAGTCCCCCCCT
CGTAAAAACGCTCTTCCCACTCTACAGTCTGAACCCGCCCTCTTCAAGGCATACCATCACATTCTGACCCATCCG
CCCCCGTCTACACCCCCTCCCACCAATCTTTCACGGCACAAGGTTGCCATGGCATTCCTTTCACAAACCCAAAAT
ATGCCCCGATGGGATGCTGCCGATACTGTCTTTTCGACTATCGCACCATGTCCACCTCGTGTGGCCACCATAGGG
CCCACGTATCCTGTCGCTATCAATGATCCCGTAAACGGCAAACTCGATTCAAAAGATAAAGAGTTTCGCTTTCCC
CCCACCATCCCACGACCTGTTTCAACTACCGAACGTCTTACTCCCCTACTTGGCCAGCAATCTCATCGGATACCC
GAACTGGCCAGGCATGTTCTTCCTCCTGTGGTGATGAGCAGAACAACACGACTCGTTCATCCCCCCGTCCTCAAT
CGAGGATCCAAACCCGTCTTGTACGGACGCGGTATTCCTGCACCATGGAATTCACATGCCATTCCCCCCACAGAC
GGTACCAACAACCCCCCACCTACACCCGTAGCAACCTCAACCAAAGATAAAATTCGAGAAAATGGAGAAACACCC
ACTAAATCTCACATTCCGGATGCTCAGCTCTTTGCGACATGGGATTTTGAAACGAAAGATTACAAGCTTCCTTTA
CCTTTATCTCATCGGCAGCATCGGACGCGTGTTGCAAGTCTTACTTCTGGTCAAAATAGTGTCAATTTGGGCACA
GCTTCACGGCCCAAGTCGGGACCTCCTAAACATGGATAA
Transcript >Agabi119p4|036320
ATGGAGTCTGCAGCCACAAAACTCGTCCACGCCGCCGCCGTCAAGACGCTGCACGCCTACAACTTTTCGCGCTCG
TCGTCCACCGCAGCGATCACCCTCTCCGACCTCCTCGCACGCTACCTCGCCCTTCTCTCAGAGTCGTGCGCCAAA
TACGCTCGTCATGCAGGCAGGACCAATCTCTCCGTGTACGATGCTGTTGCCGTTCTCGACGAACTGGGTATTGGT
ATGGACGAGCTTGCCGACTTTTGTGCTAGTGAGGCCAAGGAGCTCAATCGCTATGCGTCCAATTCTGTTCGGCGG
ATAGAAGACCTTCACGAGTTTAGAGCACATCTCTCTACCGGTCTCAAGCAGGATAATGACGACGCGATCCCACTG
CAATTTCAGATCTACCACGGCGACGACGACAGCGAGGACGAGGACGTAGACATGGAACCGCCCCCGATGCCCGTC
GACGCCCGAAAGACGCCGCCGCTCTCTCATCCGTCGCCGCCGCTTCCCCTTTCGCCCGTCTCCAATCCCTCCTCT
CCCTCCCGCAAACGCCCTCGCACAGCCAGCTGGAAACCCCCGCCTCACATCCCCGCCTTTCTTCCTCCTTTCCCC
ACCATCGAACCCCCGCCAAGCAGGCCACCGTCGCCCCACGAAACCGAGACACAGCCCGCAGAACTCATGCCACCC
CCGCCCGATAAACCTGCCGTCGTTTCTCAAGCCATGACCGCCCCTACAGCCTCCGACTATCTCGCCCAGGTTCCC
TATTCTCAATCCTCTCTTTCTTCGATACCAGAATGGCATCTACCCACTCCTCCAAAATCCTTCAAGTCCCCCCCT
CGTAAAAACGCTCTTCCCACTCTACAGTCTGAACCCGCCCTCTTCAAGGCATACCATCACATTCTGACCCATCCG
CCCCCGTCTACACCCCCTCCCACCAATCTTTCACGGCACAAGGTTGCCATGGCATTCCTTTCACAAACCCAAAAT
ATGCCCCGATGGGATGCTGCCGATACTGTCTTTTCGACTATCGCACCATGTCCACCTCGTGTGGCCACCATAGGG
CCCACGTATCCTGTCGCTATCAATGATCCCGTAAACGGCAAACTCGATTCAAAAGATAAAGAGTTTCGCTTTCCC
CCCACCATCCCACGACCTGTTTCAACTACCGAACGTCTTACTCCCCTACTTGGCCAGCAATCTCATCGGATACCC
GAACTGGCCAGGCATGTTCTTCCTCCTGTGGTGATGAGCAGAACAACACGACTCGTTCATCCCCCCGTCCTCAAT
CGAGGATCCAAACCCGTCTTGTACGGACGCGGTATTCCTGCACCATGGAATTCACATGCCATTCCCCCCACAGAC
GGTACCAACAACCCCCCACCTACACCCGTAGCAACCTCAACCAAAGATAAAATTCGAGAAAATGGAGAAACACCC
ACTAAATCTCACATTCCGGATGCTCAGCTCTTTGCGACATGGGATTTTGAAACGAAAGATTACAAGCTTCCTTTA
CCTTTATCTCATCGGCAGCATCGGACGCGTGTTGCAAGTCTTACTTCTGGTCAAAATAGTGTCAATTTGGGCACA
GCTTCACGGCCCAAGTCGGGACCTCCTAAACATGGATAA
Gene >Agabi119p4|036320
ATGGAGTCTGCAGCCACAAAACTCGTCCACGCCGCCGCCGTCAAGACGCTGCACGCCTACAACTTTTCGCGCTCG
TCGTCCACCGCAGCGATCACCCTCTCCGACCTCCTCGCACGCTACCTCGCCCTTCTCTCAGAGTCGTGCGCCAAA
TACGCTCGTCATGCAGGCAGGACCAATCTCTCCGTGTACGATGCTGTTGCCGTTCTCGACGAACTGGGTATTGGT
ATGGACGAGCTTGCCGACTTTTGTGCTAGTGAGGCCAAGGAGCTCAATCGCTATGCGTCCAATTCTGTTCGGCGG
ATAGAAGACCTTCACGAGTTTAGAGGTACGCCTTGGTTGCTGCCCTCTGCGCGTGTTTTATAGCTTTCTCTTCCA
GCACATCTCTCTACCGGTCTCAAGCAGGATAATGACGACGCGATCCCACTGCAATTTCAGATCTACCACGGCGAC
GACGACAGCGAGGACGAGGACGTAGACATGGAACCGCCCCCGATGCCCGTCGACGCCCGAAAGACGCCGCCGCTC
TCTCATCCGTCGCCGCCGCTTCCCCTTTCGCCCGTCTCCAATCCCTCCTCTCCCTCCCGCAAACGCCCTCGCACA
GCCAGCTGGAAACCCCCGCCTCACATCCCCGCCTTTCTTCCTCCTTTCCCCACCATCGAACCCCCGCCAAGCAGG
CCACCGTCGCCCCACGAAACCGAGACACAGCCCGCAGAACTCATGCCACCCCCGCCCGATAAACCTGCCGTCGTT
TCTCAAGCCATGACCGCCCCTACAGCCTCCGACTATCTCGCCCAGGTTCCCTATTCTCAATCCTCTCTTTCTTCG
ATACCAGAATGGCATCTACCCACTCCTCCAAAATCCTTCAAGTCCCCCCCTCGTAAAAACGCTCTTCCCACTCTA
CAGTCTGAACCCGCCCTCTTCAAGGCATACCATCACATTCTGACCCATCCGCCCCCGTCTACACCCCCTCCCACC
AATCTTTCACGGCACAAGGTTGCCATGGCATTCCTTTCACAAACCCAAAATATGCCCCGATGGGATGCTGCCGAT
ACTGTCTTTTCGACTATCGCACCATGTCCACCTCGTGTGGCCACCATAGGGCCCACGTATCCTGTCGCTATCAAT
GATCCCGTAAACGGCAAACTCGATTCAAAAGATAAAGAGTTTCGCTTTCCCCCCACCATCCCACGACCTGTTTCA
ACTACCGAACGTCTTACTCCCCTACTTGGCCAGCAATCTCATCGGATACCCGAACTGGCCAGGCATGTTCTTCCT
GTGAGTAGCCCATTCATGTTCCAATTCAATTATGCTGATGTACTATATAGCCTGTGGTGATGAGCAGAACAACAC
GACTCGTTCATCCCCCCGTCCTCAATCGAGGATCCAAACCCGTCTTGTACGGACGCGGTATTCCTGCACCATGGA
ATTCACATGCCATTCCCCCCACAGACGGTACCAACAACCCCCCACCTACACCCGTAGCAACCTCAACCAAAGATA
AAATTCGAGAAAATGGAGAAACACCCACTAAATCTCACATTCCGGATGCTCAGCTCTTTGCGACATGGGATTTTG
AAACGAAAGATTACAAGCTTCCTTTACCTTTATCTCATCGGCAGCATCGGACGCGTGTTGCAAGTCTTACTTCTG
GTCAAAATAGTGTCAATTTGGGCACAGCTTCACGGCCCAAGTCGGGACCTCCTAAACATGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail