Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|036040
Gene name
Locationscaffold_13:648784..656317
Strand+
Gene length (bp)7533
Transcript length (bp)6075
Coding sequence length (bp)6075
Protein length (aa) 2025

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08146 BP28CT BP28CT (NUC211) domain 1.0E-26 1759 1895
PF12397 U3snoRNP10 U3 small nucleolar RNA-associated protein 10 9.2E-16 233 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO15|UTP10_CRYNB U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UTP10 PE=3 SV=1 1 2021 0.0E+00
sp|P0CO14|UTP10_CRYNJ U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UTP10 PE=3 SV=1 1 2021 0.0E+00
sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UTP10 PE=3 SV=1 2 2020 5.0E-156
sp|Q7SY48|HEAT1_DANRE HEAT repeat-containing protein 1 OS=Danio rerio GN=heatr1 PE=2 SV=1 1 2020 2.0E-73
sp|Q0CSG1|UTP10_ASPTN U3 small nucleolar RNA-associated protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=utp10 PE=3 SV=1 861 2024 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO15|UTP10_CRYNB U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UTP10 PE=3 SV=1 1 2021 0.0E+00
sp|P0CO14|UTP10_CRYNJ U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UTP10 PE=3 SV=1 1 2021 0.0E+00
sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UTP10 PE=3 SV=1 2 2020 5.0E-156
sp|Q7SY48|HEAT1_DANRE HEAT repeat-containing protein 1 OS=Danio rerio GN=heatr1 PE=2 SV=1 1 2020 2.0E-73
sp|Q0CSG1|UTP10_ASPTN U3 small nucleolar RNA-associated protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=utp10 PE=3 SV=1 861 2024 2.0E-61
sp|A5AB61|UTP10_ASPNC U3 small nucleolar RNA-associated protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=utp10 PE=3 SV=1 861 2020 2.0E-55
sp|Q2ULC6|UTP10_ASPOR U3 small nucleolar RNA-associated protein 10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=utp10 PE=3 SV=1 861 2024 7.0E-55
sp|Q5B1X5|UTP10_EMENI U3 small nucleolar RNA-associated protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=utp10 PE=3 SV=1 861 2020 2.0E-54
sp|Q4WLI9|UTP10_ASPFU U3 small nucleolar RNA-associated protein 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=utp10 PE=3 SV=1 818 2024 5.0E-54
sp|Q1DHH9|UTP10_COCIM U3 small nucleolar RNA-associated protein 10 OS=Coccidioides immitis (strain RS) GN=UTP10 PE=3 SV=2 862 2024 2.0E-53
sp|A1CUH7|UTP10_ASPCL U3 small nucleolar RNA-associated protein 10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=utp10 PE=3 SV=1 861 2024 3.0E-52
sp|O60179|UTP10_SCHPO U3 small nucleolar RNA-associated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp10 PE=3 SV=1 851 2024 3.0E-51
sp|Q9GM44|HEAT1_MACFA HEAT repeat-containing protein 1 (Fragment) OS=Macaca fascicularis GN=HEATR1 PE=2 SV=2 1156 2020 8.0E-51
sp|A1DP58|UTP10_NEOFI U3 small nucleolar RNA-associated protein 10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=utp10 PE=3 SV=1 857 2024 5.0E-49
sp|Q9H583|HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 820 2020 1.0E-48
sp|Q6BXQ6|UTP10_DEBHA U3 small nucleolar RNA-associated protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UTP10 PE=3 SV=2 1194 1993 2.0E-45
sp|A4QTQ9|UTP10_MAGO7 U3 small nucleolar RNA-associated protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UTP10 PE=3 SV=2 1175 1994 1.0E-41
sp|A3GGS6|UTP10_PICST U3 small nucleolar RNA-associated protein 10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UTP10 PE=3 SV=2 1153 2020 2.0E-41
sp|Q6FT93|UTP10_CANGA U3 small nucleolar RNA-associated protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UTP10 PE=3 SV=1 1133 2006 2.0E-40
sp|A5AB61|UTP10_ASPNC U3 small nucleolar RNA-associated protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=utp10 PE=3 SV=1 2 358 3.0E-35
sp|Q6CJ57|UTP10_KLULA U3 small nucleolar RNA-associated protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UTP10 PE=3 SV=1 1200 1993 4.0E-35
sp|Q5B1X5|UTP10_EMENI U3 small nucleolar RNA-associated protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=utp10 PE=3 SV=1 2 364 2.0E-34
sp|A1DP58|UTP10_NEOFI U3 small nucleolar RNA-associated protein 10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=utp10 PE=3 SV=1 2 364 6.0E-34
sp|Q4WLI9|UTP10_ASPFU U3 small nucleolar RNA-associated protein 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=utp10 PE=3 SV=1 2 364 8.0E-34
sp|Q2ULC6|UTP10_ASPOR U3 small nucleolar RNA-associated protein 10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=utp10 PE=3 SV=1 2 364 2.0E-33
sp|A1CUH7|UTP10_ASPCL U3 small nucleolar RNA-associated protein 10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=utp10 PE=3 SV=1 2 364 6.0E-33
sp|Q0CSG1|UTP10_ASPTN U3 small nucleolar RNA-associated protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=utp10 PE=3 SV=1 2 364 9.0E-32
sp|Q1DHH9|UTP10_COCIM U3 small nucleolar RNA-associated protein 10 OS=Coccidioides immitis (strain RS) GN=UTP10 PE=3 SV=2 28 353 1.0E-30
sp|Q54ML4|HEAT1_DICDI HEAT repeat-containing protein 1 homolog OS=Dictyostelium discoideum GN=heatr1 PE=3 SV=1 20 330 5.0E-29
sp|Q6C457|UTP10_YARLI U3 small nucleolar RNA-associated protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UTP10 PE=3 SV=1 817 1418 2.0E-28
sp|Q754J8|UTP10_ASHGO U3 small nucleolar RNA-associated protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UTP10 PE=3 SV=1 1152 1896 2.0E-28
sp|Q6C457|UTP10_YARLI U3 small nucleolar RNA-associated protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UTP10 PE=3 SV=1 1 320 4.0E-28
sp|Q9H583|HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 1 240 3.0E-27
sp|Q9C8Z4|HEAT1_ARATH Uncharacterized protein At3g06530 OS=Arabidopsis thaliana GN=At3g06530 PE=1 SV=3 2 283 5.0E-25
sp|Q7RZM8|UTP10_NEUCR U3 small nucleolar RNA-associated protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbg-5 PE=3 SV=1 861 1405 5.0E-25
sp|Q0V1B1|UTP10_PHANO U3 small nucleolar RNA-associated protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=UTP10 PE=3 SV=2 859 1612 7.0E-25
sp|P42945|UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP10 PE=1 SV=1 1 318 1.0E-24
sp|A4QTQ9|UTP10_MAGO7 U3 small nucleolar RNA-associated protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UTP10 PE=3 SV=2 29 223 4.0E-24
sp|Q7RZM8|UTP10_NEUCR U3 small nucleolar RNA-associated protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbg-5 PE=3 SV=1 1 367 6.0E-23
sp|Q59ZX6|UTP10_CANAL U3 small nucleolar RNA-associated protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTP10 PE=3 SV=1 1227 1398 7.0E-22
sp|Q754J8|UTP10_ASHGO U3 small nucleolar RNA-associated protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UTP10 PE=3 SV=1 1 315 1.0E-21
sp|A5E212|UTP10_LODEL U3 small nucleolar RNA-associated protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UTP10 PE=3 SV=2 1227 1398 1.0E-21
sp|P42945|UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP10 PE=1 SV=1 1200 1371 2.0E-21
sp|A5DGZ7|UTP10_PICGU U3 small nucleolar RNA-associated protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UTP10 PE=3 SV=2 3 288 5.0E-21
sp|Q6FT93|UTP10_CANGA U3 small nucleolar RNA-associated protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UTP10 PE=3 SV=1 1 242 1.0E-20
sp|A5DGZ7|UTP10_PICGU U3 small nucleolar RNA-associated protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UTP10 PE=3 SV=2 1219 1350 1.0E-20
sp|A5DGZ7|UTP10_PICGU U3 small nucleolar RNA-associated protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UTP10 PE=3 SV=2 1425 1993 2.0E-20
sp|A3GGS6|UTP10_PICST U3 small nucleolar RNA-associated protein 10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UTP10 PE=3 SV=2 1 229 3.0E-20
sp|Q2HA26|UTP10_CHAGB U3 small nucleolar RNA-associated protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=UTP10 PE=3 SV=1 862 1405 1.0E-19
sp|Q9VM75|HEAT1_DROME HEAT repeat-containing protein 1 homolog OS=Drosophila melanogaster GN=l(2)k09022 PE=2 SV=2 1593 2020 6.0E-19
sp|Q6CJ57|UTP10_KLULA U3 small nucleolar RNA-associated protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UTP10 PE=3 SV=1 1 266 8.0E-18
sp|O60179|UTP10_SCHPO U3 small nucleolar RNA-associated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp10 PE=3 SV=1 2 266 2.0E-17
sp|Q59ZX6|UTP10_CANAL U3 small nucleolar RNA-associated protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTP10 PE=3 SV=1 1 242 2.0E-17
sp|Q9VM75|HEAT1_DROME HEAT repeat-containing protein 1 homolog OS=Drosophila melanogaster GN=l(2)k09022 PE=2 SV=2 1047 1354 2.0E-17
sp|Q6BXQ6|UTP10_DEBHA U3 small nucleolar RNA-associated protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UTP10 PE=3 SV=2 1 153 5.0E-17
sp|Q23495|HEAT1_CAEEL HEAT repeat-containing protein 1 homolog OS=Caenorhabditis elegans GN=toe-1 PE=3 SV=1 30 322 1.0E-16
sp|Q9VM75|HEAT1_DROME HEAT repeat-containing protein 1 homolog OS=Drosophila melanogaster GN=l(2)k09022 PE=2 SV=2 2 286 3.0E-16
sp|A5E212|UTP10_LODEL U3 small nucleolar RNA-associated protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UTP10 PE=3 SV=2 1 296 2.0E-15
sp|Q9C8Z4|HEAT1_ARATH Uncharacterized protein At3g06530 OS=Arabidopsis thaliana GN=At3g06530 PE=1 SV=3 1681 1998 1.0E-14
sp|Q6C457|UTP10_YARLI U3 small nucleolar RNA-associated protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UTP10 PE=3 SV=1 1615 2020 4.0E-12
sp|P42945|UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP10 PE=1 SV=1 1503 1993 9.0E-12
sp|Q59ZX6|UTP10_CANAL U3 small nucleolar RNA-associated protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTP10 PE=3 SV=1 1614 1993 1.0E-10
sp|A5E212|UTP10_LODEL U3 small nucleolar RNA-associated protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UTP10 PE=3 SV=2 1798 2020 2.0E-10
sp|Q23495|HEAT1_CAEEL HEAT repeat-containing protein 1 homolog OS=Caenorhabditis elegans GN=toe-1 PE=3 SV=1 1156 1336 1.0E-09
sp|Q2HA26|UTP10_CHAGB U3 small nucleolar RNA-associated protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=UTP10 PE=3 SV=1 13 124 6.0E-08
sp|Q0V1B1|UTP10_PHANO U3 small nucleolar RNA-associated protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=UTP10 PE=3 SV=2 1808 2024 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|036040
MSSLAAQLAQSASLNVALLADRSKRKPAESYLFSGRDADHHDLDAIFALGTNAFLKLSSIDDRLAPFESELFSDR
ARALDRTLLTKEEDEELNDALGEFLSLLGPWLLDAPAARILEWLVRRFRVHEFNVEHLLALFLPYHDTAQFAKLV
TILHIKPSSTWSFLLSFKSAAQNVPRVSLVTEMLRNGDVARFATSLLPSALKTDRSHRVLLAFNAATMHEFITRS
KSIDEGTMAYILPALLDPLDEEHASSRDAILGSFILLSALAHKSKLPSSTLKVVLKSMAACAEFVTAKQFLSATI
AVCEGQAELGTLPSSAVKSMLQLPNLKEDLQAAASWVGSEKLIRPLVKALISKLSDQRAVMMLESIISSPTTHPA
VIERTTSLLIKEALSQEEHVPTARSLLSAIQQRHPDIFHRASHAEQEEDEELKRTIDQLVLSLSLVSTNGSQSKD
GADMVVASTSADTSVRVVAVKELLSSLSDTSLTETDRQATVSALVSRVQDSEQVVLEALYEKPDIVAPIFAGEAS
AYIQSLSTSLGSKPKRSLFRIHLSFALRNLYRLLDTKAKKELVSDLLFPYLLFSKSRQHTAESAWDVVLEHMKTE
SGKEFEILKGCAETVKSEREKVGDNAIEKMKHINGALSTKIAQNVLVSNHLFDHLSMLLSTLQSTDPHARALGYL
VTRALLNKLSGEHQVNAARKVLETMKLEEIGGIEDLPADHDKFLDMLQELSDKNVILKPSRQGTLSWLQVSLIAT
ICSIPSPEGLVVNWLCDQSQMSANDTRGPYYVSLMRAVYALAKRSSILPVITSCLLRILFMNLKTDALVFLAGVW
TSPISFASDDNSLLQEVALLHAAAFLEAHVLEADGMDFQTILPAVLVGLQNQATGVRKAAIECLSRIRLISEKKL
KSVYKFDEVYGDVKDTLQYLDQDDLKRYLTHLVSNQQHMVQDHTYLRIAHAEHLRPAKGDRKKDIGYKNSIMYYL
LSHVNALGLEAVKIEILKSLSLVSSKMKATSLLPSVEALLNQRGDAALACLLVSSIDASSVAQLNDGVGELWNVY
LQLLEQYLQPSVDSASREVLLRILETEIFAKLVYEKQVAVCEVVFKTIVHEADVVYGKKLLSAVIQSVPLMVELL
NTYAPIPQGSTPRAAKRVKTAEPPGEETTVHQLTLLAEILGTKSLPGSLDLVSALLDTLSKVIQSSSGLRAEANY
IEQMLMSAIENAAANIPERPSVTPSVIRVDVLVEIIRVVGNPQTFNQALLLMASLARLAPESVLHNVMPVFTFMG
SNVFHRDDTYSFSVVQKTIDGIVPVMASSLKDANADSLSLYIASRDFIRVFTDAANHIPRHRRTNFFVHLVEVLG
EEHFLAPVSMLLAEKSSNRVVRQSQDEISATLALPIALLRHVAVETQVFTLLEILREVQRLVTCLRDPAIKVSTL
LDHVTDGEAAVPTGTYAKRAQTLTALIGQVIQSNTLANLSQATKQFLNILVSDLIKLATIDDAASGTKSSGVALA
AQKTLGKILSAMPAKDFMNSIEFMLTSDSEIIHNGALELSSERIPKIGDSVRNEITVTIGNIVTSIVRLLARENL
TLRMHCLKALTSIASTAVPKEEGSLTTALPSILAALSIPDLAVHALDTLIHLSTKLGPRLIPFFKDIVNKTSMFL
ENADDILLGKSTAVLHGLLISIPTFWGSDALTKIMILYMDHSRTNAGSPKPPMSSLMKTVTKKVPTKTLLPNLVD
VWVAASSNKNLDRIAAYSNVLARAIRHAPRASVIEQIRGFSRIFLEALDIVKGSNLEETKAEQQVILAFRELVIK
LNESTFRPVFRRLYDWAFVDENADVARKVTFFHTYSSLLDFFKALMVPYTSTLLKTLETHLKSFANSDDDELPAL
WVSLVTTLTKTLTYDDGGFWRDDKLRQISFPVIQQVPLCTKLSGEHDMRVLLQQCLEAIVENTSDEAVLKTINLD
LLMHTRSENAKIRHFALTCSGSLWRSHGGKFLGFVPETATFIADCGEDENDTVVRESFKLKEAVESVAGKIDGL*
Coding >Agabi119p4|036040
ATGTCCAGTCTCGCGGCGCAGTTGGCGCAATCCGCATCCCTCAATGTCGCCCTTCTCGCTGACCGTTCAAAACGC
AAACCTGCGGAATCTTACTTATTCAGTGGTCGAGATGCGGATCACCACGACCTGGATGCCATCTTCGCTCTTGGA
ACCAATGCGTTCTTAAAACTCTCTTCAATTGATGACCGTCTGGCACCATTTGAGTCGGAGCTATTTTCCGATAGA
GCGAGAGCTCTGGATAGAACTCTGTTGACAAAGGAGGAGGATGAGGAGCTGAACGATGCGCTAGGAGAGTTTCTG
AGTTTGTTGGGACCTTGGTTACTGGATGCCCCCGCTGCAAGGATATTAGAGTGGCTTGTGAGGAGATTTAGGGTA
CATGAATTCAATGTTGAGCATTTGTTAGCTCTTTTCCTTCCTTATCACGACACGGCCCAATTCGCAAAACTCGTG
ACTATCCTCCATATCAAACCCAGTTCGACCTGGAGCTTCCTTCTATCCTTCAAGTCTGCTGCCCAAAATGTGCCT
CGAGTATCCCTTGTTACCGAGATGCTTCGGAATGGGGATGTCGCACGATTTGCTACCTCTTTACTTCCTTCAGCT
CTAAAAACGGACCGATCACATCGTGTCCTGCTAGCTTTCAATGCTGCGACGATGCACGAATTCATTACGAGGAGC
AAGTCAATAGACGAAGGAACGATGGCGTATATTCTACCTGCGTTATTGGATCCACTTGATGAAGAACATGCCTCT
TCTCGGGATGCCATCCTTGGCAGCTTTATACTGCTTTCAGCGTTGGCTCACAAAAGTAAACTCCCTTCGTCAACA
CTCAAAGTTGTCTTAAAATCCATGGCTGCTTGTGCCGAATTCGTTACCGCTAAACAATTTCTTAGCGCTACCATT
GCCGTCTGTGAGGGTCAGGCAGAGTTGGGGACACTCCCGAGCTCGGCCGTGAAGTCGATGCTACAGCTACCAAAT
CTTAAGGAAGACTTGCAAGCTGCTGCCAGTTGGGTTGGTTCCGAAAAGCTAATCCGACCACTTGTCAAAGCTCTG
ATTTCGAAACTTTCGGATCAACGAGCTGTTATGATGCTGGAGTCCATTATTTCGTCGCCAACAACTCATCCTGCT
GTCATTGAACGTACCACTAGTCTGCTTATCAAGGAAGCTTTGTCCCAGGAAGAACATGTTCCCACAGCCCGTTCA
TTGCTTTCCGCTATCCAACAGCGGCACCCAGATATATTTCATCGTGCAAGTCATGCTGAACAAGAGGAGGATGAA
GAATTGAAGCGGACCATTGATCAACTTGTTTTGTCCCTCTCATTGGTTTCCACAAATGGGTCTCAAAGCAAGGAT
GGGGCAGATATGGTGGTAGCATCGACCAGCGCGGATACCAGTGTCCGAGTGGTGGCCGTCAAGGAGCTGCTTTCT
TCCCTCTCAGACACTTCTCTTACAGAAACAGATAGGCAAGCCACGGTTTCTGCACTCGTTTCTCGTGTACAGGAT
TCTGAGCAGGTGGTCCTCGAGGCACTTTACGAAAAGCCGGATATCGTTGCTCCCATCTTCGCGGGTGAAGCTTCT
GCTTACATACAAAGCCTATCCACTTCGCTTGGGTCAAAGCCCAAGAGAAGCCTTTTCCGCATACACCTTTCTTTC
GCCCTCAGAAATCTGTATCGCCTCCTCGACACCAAGGCCAAAAAGGAACTCGTGTCAGACTTGTTGTTCCCTTAT
CTATTGTTCTCAAAGTCAAGGCAGCACACCGCTGAGTCAGCATGGGATGTTGTGCTCGAGCATATGAAGACGGAG
AGCGGGAAGGAGTTCGAGATATTGAAGGGTTGCGCAGAGACAGTAAAAAGTGAGAGGGAAAAAGTGGGTGACAAC
GCGATAGAGAAGATGAAGCACATAAATGGTGCCTTAAGCACAAAAATTGCTCAAAATGTGCTTGTTTCAAACCAT
CTATTCGATCATCTATCGATGCTACTTTCGACTCTTCAGTCAACAGATCCCCATGCCCGTGCCCTGGGATACCTC
GTCACAAGAGCCCTTTTAAACAAACTTTCTGGGGAACATCAGGTGAATGCCGCAAGGAAGGTCTTAGAGACTATG
AAACTGGAAGAAATAGGTGGAATTGAAGATTTGCCTGCCGACCATGACAAGTTCCTTGATATGTTGCAGGAATTA
TCTGATAAAAATGTGATTCTCAAACCCAGCAGACAAGGTACTCTGTCTTGGCTTCAGGTATCCTTGATTGCAACG
ATTTGCTCTATTCCCTCACCGGAAGGACTGGTTGTCAATTGGTTATGCGATCAATCTCAAATGTCTGCAAACGAC
ACCCGAGGGCCATACTATGTGTCTCTTATGCGTGCGGTATACGCCCTAGCAAAGCGTTCCTCCATACTTCCCGTT
ATCACCTCTTGTCTTCTTCGCATTCTCTTCATGAACCTCAAAACAGATGCTCTCGTCTTTCTTGCTGGCGTTTGG
ACATCGCCTATTTCATTTGCTTCAGATGACAACAGCTTATTGCAAGAAGTTGCCCTTCTGCATGCAGCAGCGTTC
CTTGAGGCACACGTTCTTGAAGCTGACGGCATGGACTTCCAAACAATTTTACCGGCTGTACTTGTGGGATTGCAA
AACCAAGCCACCGGTGTCAGGAAGGCCGCCATTGAATGTCTAAGCAGGATCAGGTTGATCAGCGAGAAAAAATTG
AAGAGCGTCTACAAGTTTGATGAGGTGTATGGAGATGTTAAAGATACTTTGCAATACTTAGATCAAGATGATCTA
AAGCGCTACCTAACACACTTGGTCTCTAATCAACAGCATATGGTTCAGGATCATACATATCTGCGTATAGCCCAC
GCGGAACACCTGAGGCCTGCCAAAGGTGACCGAAAGAAAGATATCGGGTACAAGAACAGTATCATGTACTATCTC
CTCTCACACGTCAACGCGCTCGGCCTCGAGGCCGTCAAGATTGAGATTCTTAAATCACTCAGTCTTGTATCATCC
AAGATGAAGGCGACTAGCTTGCTTCCATCAGTGGAAGCACTTTTGAATCAACGAGGCGATGCGGCTTTGGCGTGC
TTACTGGTGTCTTCCATTGATGCATCCTCCGTTGCTCAACTGAATGATGGAGTGGGAGAATTGTGGAATGTCTAT
CTGCAATTGCTGGAACAATATCTTCAGCCCTCTGTTGATTCCGCGTCCCGGGAAGTTCTCTTAAGAATACTGGAG
ACAGAGATCTTCGCCAAGTTGGTGTATGAGAAACAGGTGGCTGTTTGTGAAGTAGTGTTCAAGACAATTGTACAC
GAAGCTGATGTGGTATATGGCAAGAAGCTGCTGTCCGCTGTTATCCAAAGCGTACCACTAATGGTTGAGTTGCTC
AACACGTATGCTCCTATACCTCAGGGCAGCACTCCTAGGGCGGCAAAACGGGTGAAAACAGCTGAGCCGCCCGGC
GAAGAGACTACCGTGCACCAGTTAACCCTTTTAGCTGAGATCTTGGGTACAAAATCCTTGCCAGGTTCTCTGGAT
CTTGTTTCCGCTTTGTTAGACACTCTCAGCAAGGTCATTCAAAGCTCGTCGGGACTACGGGCTGAAGCGAATTAT
ATTGAGCAAATGTTGATGTCCGCTATTGAAAACGCAGCAGCCAATATTCCCGAGCGTCCGAGTGTGACGCCGAGC
GTTATTCGTGTGGACGTGCTAGTGGAAATCATTCGAGTTGTCGGGAACCCCCAGACCTTCAATCAGGCTCTGTTA
TTAATGGCAAGTTTGGCTCGTCTGGCTCCGGAATCCGTTTTACACAACGTCATGCCCGTATTCACCTTCATGGGA
TCCAACGTCTTCCACCGCGATGATACATACAGTTTTAGTGTTGTCCAGAAGACAATTGACGGCATTGTTCCTGTC
ATGGCGTCGTCCCTCAAAGATGCTAATGCAGATTCTCTGAGTTTATACATAGCCTCAAGGGATTTTATCCGCGTC
TTTACTGATGCTGCTAATCATATCCCCCGCCACCGGAGGACGAACTTCTTCGTCCACTTAGTTGAGGTTCTAGGT
GAAGAACACTTTTTGGCTCCTGTTTCTATGCTCCTCGCAGAAAAGTCATCCAATCGAGTGGTCCGGCAAAGTCAA
GATGAAATATCTGCTACATTAGCCTTGCCCATAGCCCTGTTGCGTCACGTTGCGGTCGAAACTCAAGTTTTCACA
CTTTTGGAGATCCTGAGAGAGGTTCAACGTTTAGTTACATGCTTGAGAGACCCAGCAATCAAGGTTTCCACGTTG
TTGGATCACGTAACGGATGGGGAAGCAGCCGTTCCTACGGGCACGTATGCAAAACGGGCACAAACCCTGACTGCA
TTAATTGGTCAAGTCATACAGTCCAACACCCTGGCTAACCTAAGTCAAGCCACGAAACAGTTTCTCAACATTCTA
GTTTCCGACCTCATTAAGCTAGCAACTATTGACGATGCTGCATCTGGCACCAAATCTAGTGGAGTTGCTCTCGCT
GCTCAAAAAACTCTTGGAAAGATTCTCAGCGCAATGCCGGCAAAGGATTTCATGAACTCGATCGAATTCATGCTA
ACCTCAGACAGCGAGATTATCCACAATGGTGCCCTGGAGCTCTCAAGCGAACGGATACCGAAAATAGGCGATAGC
GTCCGCAATGAAATTACGGTGACTATTGGCAATATTGTAACCTCGATCGTCCGACTATTGGCACGGGAAAACCTC
ACGTTACGCATGCATTGCTTGAAAGCTCTGACGTCCATTGCATCTACCGCGGTGCCGAAGGAAGAAGGATCATTA
ACCACTGCTTTACCATCGATTCTTGCCGCTTTAAGCATCCCTGATCTTGCGGTGCATGCACTGGACACACTCATT
CATTTGTCAACCAAGCTGGGACCCAGGCTCATACCGTTCTTTAAAGATATTGTCAACAAGACCTCAATGTTTTTG
GAGAATGCGGATGACATCCTACTTGGGAAGTCCACTGCCGTCCTGCACGGTCTTCTCATATCCATTCCCACATTT
TGGGGTTCTGATGCCCTTACAAAAATAATGATCCTGTACATGGACCACAGCCGTACAAATGCAGGCTCACCCAAA
CCACCGATGTCTTCGCTTATGAAAACTGTCACAAAAAAGGTTCCGACAAAAACCCTCTTACCAAACCTTGTCGAT
GTTTGGGTGGCAGCTTCTTCTAACAAGAATCTGGATCGCATTGCAGCATATTCGAACGTTTTGGCTCGAGCCATT
CGTCACGCTCCTCGAGCTTCTGTTATCGAACAAATTCGTGGCTTTTCAAGAATTTTCCTGGAAGCGCTTGACATC
GTTAAGGGATCAAATTTGGAAGAAACCAAGGCGGAGCAACAAGTCATTTTGGCGTTTAGGGAACTCGTCATTAAA
TTAAACGAGTCAACTTTCAGACCGGTCTTTCGGCGTTTGTACGATTGGGCCTTCGTCGATGAAAACGCCGACGTC
GCGAGGAAGGTCACATTCTTCCACACTTATTCGAGTTTGCTTGATTTCTTCAAGGCTCTCATGGTACCATATACT
TCAACTTTGCTAAAAACTCTTGAGACACATCTCAAATCCTTTGCAAACTCTGATGATGACGAACTTCCCGCTCTT
TGGGTCTCCCTTGTCACGACGCTCACGAAGACTCTTACTTACGATGACGGAGGTTTTTGGCGAGATGACAAACTC
AGGCAAATATCTTTTCCGGTAATCCAGCAAGTACCTTTGTGTACCAAACTCTCTGGAGAACATGATATGAGGGTA
CTCCTTCAACAATGCTTGGAGGCCATAGTCGAGAATACGAGTGATGAAGCAGTGCTCAAAACCATCAATCTTGAT
CTCCTCATGCATACACGTTCTGAAAATGCTAAAATCCGTCACTTTGCTTTGACTTGCTCGGGATCACTCTGGCGT
TCACATGGCGGCAAATTCCTTGGCTTCGTCCCCGAGACGGCCACATTCATAGCAGATTGTGGCGAGGACGAAAAT
GACACAGTTGTCAGAGAATCATTCAAATTGAAAGAAGCTGTAGAAAGTGTTGCAGGAAAGATAGACGGCTTGTAA
Transcript >Agabi119p4|036040
ATGTCCAGTCTCGCGGCGCAGTTGGCGCAATCCGCATCCCTCAATGTCGCCCTTCTCGCTGACCGTTCAAAACGC
AAACCTGCGGAATCTTACTTATTCAGTGGTCGAGATGCGGATCACCACGACCTGGATGCCATCTTCGCTCTTGGA
ACCAATGCGTTCTTAAAACTCTCTTCAATTGATGACCGTCTGGCACCATTTGAGTCGGAGCTATTTTCCGATAGA
GCGAGAGCTCTGGATAGAACTCTGTTGACAAAGGAGGAGGATGAGGAGCTGAACGATGCGCTAGGAGAGTTTCTG
AGTTTGTTGGGACCTTGGTTACTGGATGCCCCCGCTGCAAGGATATTAGAGTGGCTTGTGAGGAGATTTAGGGTA
CATGAATTCAATGTTGAGCATTTGTTAGCTCTTTTCCTTCCTTATCACGACACGGCCCAATTCGCAAAACTCGTG
ACTATCCTCCATATCAAACCCAGTTCGACCTGGAGCTTCCTTCTATCCTTCAAGTCTGCTGCCCAAAATGTGCCT
CGAGTATCCCTTGTTACCGAGATGCTTCGGAATGGGGATGTCGCACGATTTGCTACCTCTTTACTTCCTTCAGCT
CTAAAAACGGACCGATCACATCGTGTCCTGCTAGCTTTCAATGCTGCGACGATGCACGAATTCATTACGAGGAGC
AAGTCAATAGACGAAGGAACGATGGCGTATATTCTACCTGCGTTATTGGATCCACTTGATGAAGAACATGCCTCT
TCTCGGGATGCCATCCTTGGCAGCTTTATACTGCTTTCAGCGTTGGCTCACAAAAGTAAACTCCCTTCGTCAACA
CTCAAAGTTGTCTTAAAATCCATGGCTGCTTGTGCCGAATTCGTTACCGCTAAACAATTTCTTAGCGCTACCATT
GCCGTCTGTGAGGGTCAGGCAGAGTTGGGGACACTCCCGAGCTCGGCCGTGAAGTCGATGCTACAGCTACCAAAT
CTTAAGGAAGACTTGCAAGCTGCTGCCAGTTGGGTTGGTTCCGAAAAGCTAATCCGACCACTTGTCAAAGCTCTG
ATTTCGAAACTTTCGGATCAACGAGCTGTTATGATGCTGGAGTCCATTATTTCGTCGCCAACAACTCATCCTGCT
GTCATTGAACGTACCACTAGTCTGCTTATCAAGGAAGCTTTGTCCCAGGAAGAACATGTTCCCACAGCCCGTTCA
TTGCTTTCCGCTATCCAACAGCGGCACCCAGATATATTTCATCGTGCAAGTCATGCTGAACAAGAGGAGGATGAA
GAATTGAAGCGGACCATTGATCAACTTGTTTTGTCCCTCTCATTGGTTTCCACAAATGGGTCTCAAAGCAAGGAT
GGGGCAGATATGGTGGTAGCATCGACCAGCGCGGATACCAGTGTCCGAGTGGTGGCCGTCAAGGAGCTGCTTTCT
TCCCTCTCAGACACTTCTCTTACAGAAACAGATAGGCAAGCCACGGTTTCTGCACTCGTTTCTCGTGTACAGGAT
TCTGAGCAGGTGGTCCTCGAGGCACTTTACGAAAAGCCGGATATCGTTGCTCCCATCTTCGCGGGTGAAGCTTCT
GCTTACATACAAAGCCTATCCACTTCGCTTGGGTCAAAGCCCAAGAGAAGCCTTTTCCGCATACACCTTTCTTTC
GCCCTCAGAAATCTGTATCGCCTCCTCGACACCAAGGCCAAAAAGGAACTCGTGTCAGACTTGTTGTTCCCTTAT
CTATTGTTCTCAAAGTCAAGGCAGCACACCGCTGAGTCAGCATGGGATGTTGTGCTCGAGCATATGAAGACGGAG
AGCGGGAAGGAGTTCGAGATATTGAAGGGTTGCGCAGAGACAGTAAAAAGTGAGAGGGAAAAAGTGGGTGACAAC
GCGATAGAGAAGATGAAGCACATAAATGGTGCCTTAAGCACAAAAATTGCTCAAAATGTGCTTGTTTCAAACCAT
CTATTCGATCATCTATCGATGCTACTTTCGACTCTTCAGTCAACAGATCCCCATGCCCGTGCCCTGGGATACCTC
GTCACAAGAGCCCTTTTAAACAAACTTTCTGGGGAACATCAGGTGAATGCCGCAAGGAAGGTCTTAGAGACTATG
AAACTGGAAGAAATAGGTGGAATTGAAGATTTGCCTGCCGACCATGACAAGTTCCTTGATATGTTGCAGGAATTA
TCTGATAAAAATGTGATTCTCAAACCCAGCAGACAAGGTACTCTGTCTTGGCTTCAGGTATCCTTGATTGCAACG
ATTTGCTCTATTCCCTCACCGGAAGGACTGGTTGTCAATTGGTTATGCGATCAATCTCAAATGTCTGCAAACGAC
ACCCGAGGGCCATACTATGTGTCTCTTATGCGTGCGGTATACGCCCTAGCAAAGCGTTCCTCCATACTTCCCGTT
ATCACCTCTTGTCTTCTTCGCATTCTCTTCATGAACCTCAAAACAGATGCTCTCGTCTTTCTTGCTGGCGTTTGG
ACATCGCCTATTTCATTTGCTTCAGATGACAACAGCTTATTGCAAGAAGTTGCCCTTCTGCATGCAGCAGCGTTC
CTTGAGGCACACGTTCTTGAAGCTGACGGCATGGACTTCCAAACAATTTTACCGGCTGTACTTGTGGGATTGCAA
AACCAAGCCACCGGTGTCAGGAAGGCCGCCATTGAATGTCTAAGCAGGATCAGGTTGATCAGCGAGAAAAAATTG
AAGAGCGTCTACAAGTTTGATGAGGTGTATGGAGATGTTAAAGATACTTTGCAATACTTAGATCAAGATGATCTA
AAGCGCTACCTAACACACTTGGTCTCTAATCAACAGCATATGGTTCAGGATCATACATATCTGCGTATAGCCCAC
GCGGAACACCTGAGGCCTGCCAAAGGTGACCGAAAGAAAGATATCGGGTACAAGAACAGTATCATGTACTATCTC
CTCTCACACGTCAACGCGCTCGGCCTCGAGGCCGTCAAGATTGAGATTCTTAAATCACTCAGTCTTGTATCATCC
AAGATGAAGGCGACTAGCTTGCTTCCATCAGTGGAAGCACTTTTGAATCAACGAGGCGATGCGGCTTTGGCGTGC
TTACTGGTGTCTTCCATTGATGCATCCTCCGTTGCTCAACTGAATGATGGAGTGGGAGAATTGTGGAATGTCTAT
CTGCAATTGCTGGAACAATATCTTCAGCCCTCTGTTGATTCCGCGTCCCGGGAAGTTCTCTTAAGAATACTGGAG
ACAGAGATCTTCGCCAAGTTGGTGTATGAGAAACAGGTGGCTGTTTGTGAAGTAGTGTTCAAGACAATTGTACAC
GAAGCTGATGTGGTATATGGCAAGAAGCTGCTGTCCGCTGTTATCCAAAGCGTACCACTAATGGTTGAGTTGCTC
AACACGTATGCTCCTATACCTCAGGGCAGCACTCCTAGGGCGGCAAAACGGGTGAAAACAGCTGAGCCGCCCGGC
GAAGAGACTACCGTGCACCAGTTAACCCTTTTAGCTGAGATCTTGGGTACAAAATCCTTGCCAGGTTCTCTGGAT
CTTGTTTCCGCTTTGTTAGACACTCTCAGCAAGGTCATTCAAAGCTCGTCGGGACTACGGGCTGAAGCGAATTAT
ATTGAGCAAATGTTGATGTCCGCTATTGAAAACGCAGCAGCCAATATTCCCGAGCGTCCGAGTGTGACGCCGAGC
GTTATTCGTGTGGACGTGCTAGTGGAAATCATTCGAGTTGTCGGGAACCCCCAGACCTTCAATCAGGCTCTGTTA
TTAATGGCAAGTTTGGCTCGTCTGGCTCCGGAATCCGTTTTACACAACGTCATGCCCGTATTCACCTTCATGGGA
TCCAACGTCTTCCACCGCGATGATACATACAGTTTTAGTGTTGTCCAGAAGACAATTGACGGCATTGTTCCTGTC
ATGGCGTCGTCCCTCAAAGATGCTAATGCAGATTCTCTGAGTTTATACATAGCCTCAAGGGATTTTATCCGCGTC
TTTACTGATGCTGCTAATCATATCCCCCGCCACCGGAGGACGAACTTCTTCGTCCACTTAGTTGAGGTTCTAGGT
GAAGAACACTTTTTGGCTCCTGTTTCTATGCTCCTCGCAGAAAAGTCATCCAATCGAGTGGTCCGGCAAAGTCAA
GATGAAATATCTGCTACATTAGCCTTGCCCATAGCCCTGTTGCGTCACGTTGCGGTCGAAACTCAAGTTTTCACA
CTTTTGGAGATCCTGAGAGAGGTTCAACGTTTAGTTACATGCTTGAGAGACCCAGCAATCAAGGTTTCCACGTTG
TTGGATCACGTAACGGATGGGGAAGCAGCCGTTCCTACGGGCACGTATGCAAAACGGGCACAAACCCTGACTGCA
TTAATTGGTCAAGTCATACAGTCCAACACCCTGGCTAACCTAAGTCAAGCCACGAAACAGTTTCTCAACATTCTA
GTTTCCGACCTCATTAAGCTAGCAACTATTGACGATGCTGCATCTGGCACCAAATCTAGTGGAGTTGCTCTCGCT
GCTCAAAAAACTCTTGGAAAGATTCTCAGCGCAATGCCGGCAAAGGATTTCATGAACTCGATCGAATTCATGCTA
ACCTCAGACAGCGAGATTATCCACAATGGTGCCCTGGAGCTCTCAAGCGAACGGATACCGAAAATAGGCGATAGC
GTCCGCAATGAAATTACGGTGACTATTGGCAATATTGTAACCTCGATCGTCCGACTATTGGCACGGGAAAACCTC
ACGTTACGCATGCATTGCTTGAAAGCTCTGACGTCCATTGCATCTACCGCGGTGCCGAAGGAAGAAGGATCATTA
ACCACTGCTTTACCATCGATTCTTGCCGCTTTAAGCATCCCTGATCTTGCGGTGCATGCACTGGACACACTCATT
CATTTGTCAACCAAGCTGGGACCCAGGCTCATACCGTTCTTTAAAGATATTGTCAACAAGACCTCAATGTTTTTG
GAGAATGCGGATGACATCCTACTTGGGAAGTCCACTGCCGTCCTGCACGGTCTTCTCATATCCATTCCCACATTT
TGGGGTTCTGATGCCCTTACAAAAATAATGATCCTGTACATGGACCACAGCCGTACAAATGCAGGCTCACCCAAA
CCACCGATGTCTTCGCTTATGAAAACTGTCACAAAAAAGGTTCCGACAAAAACCCTCTTACCAAACCTTGTCGAT
GTTTGGGTGGCAGCTTCTTCTAACAAGAATCTGGATCGCATTGCAGCATATTCGAACGTTTTGGCTCGAGCCATT
CGTCACGCTCCTCGAGCTTCTGTTATCGAACAAATTCGTGGCTTTTCAAGAATTTTCCTGGAAGCGCTTGACATC
GTTAAGGGATCAAATTTGGAAGAAACCAAGGCGGAGCAACAAGTCATTTTGGCGTTTAGGGAACTCGTCATTAAA
TTAAACGAGTCAACTTTCAGACCGGTCTTTCGGCGTTTGTACGATTGGGCCTTCGTCGATGAAAACGCCGACGTC
GCGAGGAAGGTCACATTCTTCCACACTTATTCGAGTTTGCTTGATTTCTTCAAGGCTCTCATGGTACCATATACT
TCAACTTTGCTAAAAACTCTTGAGACACATCTCAAATCCTTTGCAAACTCTGATGATGACGAACTTCCCGCTCTT
TGGGTCTCCCTTGTCACGACGCTCACGAAGACTCTTACTTACGATGACGGAGGTTTTTGGCGAGATGACAAACTC
AGGCAAATATCTTTTCCGGTAATCCAGCAAGTACCTTTGTGTACCAAACTCTCTGGAGAACATGATATGAGGGTA
CTCCTTCAACAATGCTTGGAGGCCATAGTCGAGAATACGAGTGATGAAGCAGTGCTCAAAACCATCAATCTTGAT
CTCCTCATGCATACACGTTCTGAAAATGCTAAAATCCGTCACTTTGCTTTGACTTGCTCGGGATCACTCTGGCGT
TCACATGGCGGCAAATTCCTTGGCTTCGTCCCCGAGACGGCCACATTCATAGCAGATTGTGGCGAGGACGAAAAT
GACACAGTTGTCAGAGAATCATTCAAATTGAAAGAAGCTGTAGAAAGTGTTGCAGGAAAGATAGACGGCTTGTAA
Gene >Agabi119p4|036040
ATGTCCAGTCTCGCGGCGCAGTTGGCGCAATCCGCATCCCTCAATGTCGCCCTTCTCGCTGACCGTTCAAAACGC
AAACCTGCGGAATCTTACTTATTCAGTGGTCGAGATGCGGATCACCACGACCTGGATGCCATCTTCGCTCTTGGA
ACCAATGCGTTCTTAAAACTCTCTTCAATTGATGACCGTCTGGCACCATTTGAGTCGGAGCTATTTTCCGATAGA
GCGAGAGCTCTGGATAGAACTCTGTTGACAAAGGAGGAGGATGAGGAGCTGAACGATGCGCTAGGAGAGTTTCTG
AGTTTGTTGGGACCTTGGTTACTGGATGCCCCCGCTGCAAGGATATTAGAGTGGCTTGTGAGGAGATTTAGGTGA
GTGCTCTGACTATCATTACCCAACCATGGACTCAACCTCCCCAGGGTACATGAATTCAATGTTGAGCATTTGTTA
GCTCTTTTCCTTCCTTATCACGACACGGCCCAATTCGCAAAACTCGTGACTATCCTCCATATCAAGTAAGACTAC
TCGAGTTGAAAGATTCCCTTCCTAAATTGAACACGTCTAGACCCAGTTCGACCTGGAGCTTCCTTCTATCCTTCA
AGTCTGCTGCCCAAAATGTGCCTCGAGTATCCCTTGTTACCGAGATGCTTCGGAATGGGGATGTCGCACGATTTG
CTACCTCTTTACTTCCTTCAGCTCTAAAAACGGACCGATCACATCGTGTCCTGCTAGCTTTCAATGCTGCGACGA
TGCACGAATTCATTACGAGGAGCAAGTCAATAGACGAAGGAACGATGGCGTATATTCTACCTGCGTTATTGGATC
CACTTGATGAAGAACATGCCTCTTCTCGGGATGCCATCGTACGTGCTTTAGTTTCTTTCCATCTTTTAATCCCGT
GTCGACTTTGATTTCTAGCTTGGCAGCTTTATACTGCTTTCAGCGTTGGCTCACAAAAGTAAACTCCCTTCGTCA
ACACTCAAAGTTGTCTTAAAATCCATGGCTGCTTGTGCCGAATTCGTTACCGCTAAACAATTTCTTAGCGCTACC
ATTGCCGTCTGTGAGGGTCAGGCAGAGTTGGGGACACTCCCGAGCTCGGCCGTGAAGTCGATGCTACAGCTACCG
TGAGCAGCACCTTAACATATCCTACCAAACTCTTATGATCGTTTTAGAAATCTTAAGGAAGACTTGCAAGCTGCT
GCCAGTTGGGTTGGTTCCGAAAAGCTAATCCGACCACTTGTCAAAGCTCTGATTTCGAAGTACGTTGTTCTCCTT
CGATGATACACGCACGGGGCCGCTGACTATGGTGCTGAAGACTTTCGGATCAACGAGCTGTTATGATGCTGGAGT
CCATTATTTCGTCGCCAACAACTCATCCTGCTGTCATTGAACGTACCACTAGTCTGCTTATCAAGGAAGCTTTGT
CCCAGGAAGAACATGTTCCCACAGCCCGTTCATTGCTTTCCGCTATCCAACAGCGGCACCCAGATATATTTCATC
GTGCAAGTCATGCTGAACAAGAGGAGGATGAAGAATTGAAGCGGACCATTGATCAACTTGTTTTGTCCCTCTCAT
TGGTATGTGTCGGATAATTTTCGTGTATTTTCATCTCATGATGTTCTTTTGCAGGTTTCCACAAATGGGTCTCAA
AGCAAGGATGGGGCAGATATGGTGGTAGCATCGACCAGCGCGGATACCAGTGTCCGAGTGGTGGCCGTCAAGGAG
CTGCTTTCTTCCCTCTCAGACACTTCTCTTACAGAAACAGATAGGGTAAGATGATTTCACTTTGAAGTTTAGAGT
CACGCTGACACTGAAGTACAGCAAGCCACGGTTTCTGCACTCGTTTCTCGTGTACAGGATTCTGAGCAGGTGGTC
CTCGAGGCACTTTACGAAAAGCCGGATATCGTTGCTCCCATCTTCGCGGGTGAAGCTTCTGCTTACATACAAAGC
CTATCCACTTCGCTTGGGTCAAAGCCCAAGAGAAGCCTTTTCCGCATACACCTTTCTTTCGCCCTCAGAAATCTG
TATCGCCTCCTCGACACCAAGGCCAAAAAGGAACTCGTGTCAGACTTGTTGTTCCCTTATCTATTGTTCTCAAAG
TCAAGGCAGCACACCGCTGAGTCAGCATGGGATGTTGTGCTCGAGCATATGAAGACGGAGAGCGGGAAGGAGTTC
GAGATATTGAAGGGTTGCGCAGAGACAGTAAAAAGTGAGAGGGAAAAAGTGGGTGACAACGCGATAGAGAAGATG
AAGCACATAAATGGTGCCTTAAGCACAAAAATTGCTCGTGAGTATACTATTCTTTTCATTCACTTACTCTGAACA
TCGTTTCAGAAAATGTGCTTGTTTCAAACCATCTATTCGATCATCTATCGATGCTACTTTCGACTCTTCAGTCAA
CAGATCCCCATGCCCGTGCCCTGGGATACCTCGTCACAAGAGCCCTTTTAAACAAACTTTCTGGGGAACATCAGG
TGAATGCCGCAAGGAAGGTCTTAGAGACTATGAAACTGGAAGAAATAGGTGGAATTGAAGATTTGCCTGCCGACC
ATGACAAGTTCCTTGATGTATGTCCTTTTATGCTTGCGGTTGAAGTATATTTGAATCCTGGTTGCTAGATGTTGC
AGGAATTATCTGATAAAAATGTGATTCTCAAACCCAGCAGACAAGGTACTCTGTCTTGGCTTCAGGTATCCTTGA
TTGCAACGATTTGCTCTATTCCCTCACCGGAAGGACTGGTTGTCAATTGGTTATGCGATCAATCTCAAGTAGGTT
TTCTTTTACATTGCGCTTGGCGGTTAACAAAGCTGATTGCACATAGATGTCTGCAAACGACACCCGAGGGCCATA
CTATGTGTCTCTTATGCGTGCGGTATACGCCCTAGCAAAGCGTTCCTCCATACTTCCCGTTATCACCTCTTGTCT
TCTTCGCATTCTCTTCATGAACCTCAAAACAGATGCTCTCGTCTTTCTTGCTGGCGTTTGGACATCGCCTATTTC
ATTTGCTTCAGATGACAACAGCTTATTGCAAGAAGTTGCCCTTCTGCATGCAGCAGCGTTCCTTGAGGCACACGT
TCTTGAAGCTGACGGCATGGACTTCCAAACAATTTTACCGGCTGTACTTGTGGGATTGCAAAACCAAGCCACCGG
TGTCAGGAAGGCCGCCATTGAATGTCTAAGCAGGATCAGGTTGATCAGCGAGAAAAAATTGAAGAGCGTCTACAA
GTTTGATGAGGTGTATGGAGATGTTAAAGGTGCGTTCACTTCTGTCAAGGTATGCTGGCCGATGTGTTGACTTGA
GTGCCCATCAGATACTTTGCAATACTTAGATCAAGATGATCTAAAGCGCTACCTAACACACTTGGTCTCTAATCA
ACAGCATATGGTTCAGGATCATACATATCTGCGTATAGCCCACGCGGAACACCTGAGGCCTGCCAAAGGTGACCG
AAAGAAAGATATCGGGTAAGCTTTCTACACCTCCGACAAGACATGATATTAACATCATTGGTTAGGTACAAGAAC
AGTATCATGTACTATCTCCTCTCACACGTCAACGCGCTCGGCCTCGAGGCCGTCAAGATTGAGATTCTTAAATCA
CTCAGTCTTGTATCATCCAAGATGAAGGCGACTAGCTTGCTTCCATCAGTGGAAGCACTTTTGAATCAACGAGGC
GATGCGGCTTTGGCGTGCTTACTGGTGTCTTCCATTGATGCATCCTCCGTTGCTCAACTGAATGATGGAGTGGGA
GAATTGTGGAATGTCTATCTGCAATTGCTGGAACAATATCTTCAGCCCTCTGTTGATTCCGCGTCCCGGGAAGTT
CTCTTAAGAATACTGGAGACAGAGATCTTCGCCAAGTTGGTGTATGAGAAACAGGTGGCTGTTTGTGAAGTAGTG
TTCAAGACAATTGTACACGAAGCTGATGTGGTGGGTAGTCGGTATGAGTATGGCAATAAGTTTTACTGACTGCGA
GATTCTTCATCTGGCAGGTATATGGCAAGAAGCTGCTGTCCGCTGTTATCCAAAGCGTACCACTAATGGTTGAGT
TGCTCAACACGTATGCTCCTATACCTCAGGGCAGCACTCCTAGGGCGGCAAAACGGGTGAAAACAGCTGAGTGAG
TGTCAATCCTTGATTCTTCCACTCTACGAACTTGCTGATGACTTTAAGGCCGCCCGGCGAAGAGACTACCGTGCA
CCAGTTAACCCTTTTAGCTGAGATCTTGGGTACAAAATCCTTGCCAGGTTCTCTGGATCTTGTTTCCGCTTTGTT
AGACACTCTCAGCAAGGTCATTCAAAGCTCGTCGGGACTACGGGCTGAAGCGAATTATATTGAGCAAATGTTGAT
GTCCGCTATTGAAAACGCAGCAGCCAATATTCCCGTACGATTAAACATCTGCGTCATGGTTGACTTACTCAATGT
TTTTGCAGGAGCGTCCGAGTGTGACGCCGAGCGTTATTCGTGTGGACGTGCTAGTGGAAATCATTCGAGGTGATA
CCATCTTTTTTCTACTGCTGGAGGGTATACTGATGAAGATTCAGTTGTCGGGAACCCCCAGACCTTCAATCAGGC
TCTGTTATTAATGGCAAGTTTGGCTCGTCTGGCTCCGGAATCCGTTTTACACAACGTCATGCCCGTATTCACCTT
CATGGGATCCAACGTCTTCCACCGCGATGATACATACAGTTTTAGTGTTGTCCAGAAGGTATGCAGTCACTCAAT
CGAGTCCTGTAAGAATTAACATATTATCAGACAATTGACGGCATTGTTCCTGTCATGGCGTCGTCCCTCAAAGAT
GCTAATGCAGATTCTCTGAGTTTATACATAGCCTCAAGGGATTTTATCCGCGTCTTTACTGATGCTGCTAATCAT
ATCCCCCGCCACCGGAGGACGAAGTATGTCTGTGCTTGACTCTTCTGATCATGCCACCTGATATGCTTCATTAGC
TTCTTCGTCCACTTAGTTGAGGTTCTAGGTGAAGAACACTTTTTGGCTCCTGTTTCTATGCTCCTCGCAGAAAAG
TCATCCAATCGAGTGGTCCGGCAAAGTCAAGATGAAATATCTGCTACATTAGCCTTGCCCATAGCCCTGTTGCGT
CACGTTGCGGTCGAAACTCAAGTTTTCACACTTTTGGAGATCCTGAGAGAGGTTCAACGTTTAGTTACATGCTTG
AGAGACCCAGCAATCAAGGTTTCCACGTTGTTGGATCACGTAACGTACGTGCTTTTAATCTTCCTTCACCCGAAC
GGGAGTTGACGAGGAGTCAGGGATGGGGAAGCAGCCGTTCCTACGGGCACGTATGCAAAACGGGCACAAACCCTG
ACTGCATTAATTGGTCAAGTCATACAGTCCAACACCCTGGCTAACCTAAGTCAAGCCACGAAACAGTTTCTCAAC
ATTCTAGTTTCCGACCTCATTAAGCTAGCAACTATTGACGATGCTGCATCTGGCACCAAATCTAGTGGAGTTGCT
CTCGCTGCTCAAAAAACTCTTGGAAAGATTCTCAGCGCAATGCCGGCAAAGGATTTCATGAACTCGATCGAATTC
ATGCTAACCTCAGACAGCGAGATTGTATATACCATTCCTTCGCCTTTTGGGAAACTACTTACCTTATCCGTAGAT
CCACAATGGTGCCCTGGAGCTCTCAAGCGAACGGATACCGAAAATAGGCGATAGCGTCCGCAATGAAATTACGGT
GACTATTGGCAATATTGTAACCTCGATCGTCCGACTATTGGCACGGGAAAACCTCACGTTACGCATGCATTGCTT
GAAAGCTCTGACGTCCATTGCATCTACCGCGGTGCCGAAGGAAGAAGGATCATTAACCACTGCTTTACCATCGAT
TCTTGCCGCTTTAAGCATCCCTGATCTTGCGGTGCATGCACTGGACACACTCATTCATTTGTCGTACGTATTTGA
GTCTTGAGATATACCTATTTTAGATAACCATGCATATCACAGAACCAAGCTGGGACCCAGGCTCATACCGTTCTT
TAAAGATATTGTCAACAAGACCTCAATGTTTTTGGAGAATGCGGATGACAGTGAGTCTTTTGCGCATTTCCGCAG
CTGATCTATTAACAATCCCGGATAGTCCTACTTGGGAAGTCCACTGCCGTCCTGCACGGTCTTCTCATATCCATT
CCCACATTTTGGGGTTCTGATGCCCTTACAAAAATAATGATCCTGTACATGGACCACAGCCGTACAAATGCAGGC
TCACCCAAACCACCGATGTCTTCGCTTATGAAAACTGTCACAAAAAAGGTTCCGACAAAAACCCTCTTACCAAAC
CTTGTCGATGTTTGGGTGGCAGCTTCTTCTAACAAGAATCTGGTAAGCTGCTTCATGTGGAACATGTGTTGAAGT
TATACTGATTTTGGGTAAAGGATCGCATTGCAGCATATTCGAACGTTTTGGCTCGAGCCATTCGTCACGCTCCTC
GAGCTTCTGTTATCGAACAAATTCGTGGCTTTTCAAGAATTTTCCTGGAAGCGCTTGACATCGTTAAGGGATCAA
ATTTGGAAGAAACCAAGGTGATTCAAATGTGACGAAAAATGAGAGGGTAACGGAGAGCTGATCGTGTCTGACAGG
CGGAGCAACAAGTCATTTTGGCGTTTAGGGAACTCGTCATTAAATTAAACGAGTCAACTTTCAGACCGGTCTTTC
GGCGTTTGTACGATTGGGCCTTCGTCGATGAAAACGGTGCGTTGCTATCAAGTTCATAGATCTACACGCATGCTA
GAGTACCATCATTAGCCGACGTCGCGAGGAAGGTCACATTCTTCCACACTTATTCGAGTTTGCTTGATTTCTTCA
AGGTCTGTTTAGTTATATGCGACTTGTGCTTGGCATGATTAACCTTATTATCGCAGGCTCTCATGGTACCATATA
CTTCAACTTTGCTAAAAACTCTTGAGACACATCTCAAATCCTTTGCAAACTCTGATGATGACGAACTTCCCGCTC
TTTGGGTCTCCCTTGTCACGACGCTCACGAAGACTCTTACTTACGATGACGGAGGTACTTTTAGTCATCATAAGT
GGCCCGGAAATTTTATTGATCTTATATGCAGGTTTTTGGCGAGATGACAAACTCAGGCAAATATCTTTTCCGGTA
ATCCAGCAAGTACCTTTGTGTACCAAACTCTCTGGAGAACATGATATGAGGGTACTCCTTCAACAATGCTTGGAG
GCCATAGTCGAGAATACGAGTGATGAAGCAGTGCTCAAAACCATCAATCTTGATCTCCTCATGCATACACGTTCT
GAAAATGCTAAAATCCGTCACTTTGCTTTGACTTGCTCGGGATCACTCTGGCGTTCACATGGCGGCAAATTCCTT
GGTGAGTCAATTTCCATACTCCATTAGTCATACGAGACTCAGGTATTACTGGCAGGCTTCGTCCCCGAGACGGCC
ACATTCATAGCAGATTGTGGCGAGGACGAAAATGACACAGTTGTCAGAGAATCATTCAAATTGAAAGAAGCTGTA
GAAAGTGTTGCAGGAAAGATAGACGGCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail