Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|035740
Gene name
Locationscaffold_13:556174..557640
Strand-
Gene length (bp)1466
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03556 Cullin_binding Cullin binding 2.8E-33 187 327
PF14555 UBA_4 UBA-like domain 2.6E-06 57 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN07|DCN1_CRYNB Defective in cullin neddylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DCN1 PE=3 SV=1 47 329 8.0E-57
sp|P0CN06|DCN1_CRYNJ Defective in cullin neddylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DCN1 PE=3 SV=1 47 329 8.0E-57
sp|Q4PF67|DCN1_USTMA Defective in cullin neddylation protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DCN1 PE=3 SV=1 54 325 3.0E-41
sp|Q8BZJ7|DCNL2_MOUSE DCN1-like protein 2 OS=Mus musculus GN=Dcun1d2 PE=1 SV=3 58 329 2.0E-35
sp|Q1RMX9|DCNL5_BOVIN DCN1-like protein 5 OS=Bos taurus GN=DCUN1D5 PE=2 SV=1 98 334 7.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN07|DCN1_CRYNB Defective in cullin neddylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DCN1 PE=3 SV=1 47 329 8.0E-57
sp|P0CN06|DCN1_CRYNJ Defective in cullin neddylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DCN1 PE=3 SV=1 47 329 8.0E-57
sp|Q4PF67|DCN1_USTMA Defective in cullin neddylation protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DCN1 PE=3 SV=1 54 325 3.0E-41
sp|Q8BZJ7|DCNL2_MOUSE DCN1-like protein 2 OS=Mus musculus GN=Dcun1d2 PE=1 SV=3 58 329 2.0E-35
sp|Q1RMX9|DCNL5_BOVIN DCN1-like protein 5 OS=Bos taurus GN=DCUN1D5 PE=2 SV=1 98 334 7.0E-35
sp|Q9BTE7|DCNL5_HUMAN DCN1-like protein 5 OS=Homo sapiens GN=DCUN1D5 PE=1 SV=1 98 329 2.0E-34
sp|Q5PPL2|DCNL5_RAT DCN1-like protein 5 OS=Rattus norvegicus GN=Dcun1d5 PE=2 SV=1 98 329 2.0E-34
sp|Q9CXV9|DCNL5_MOUSE DCN1-like protein 5 OS=Mus musculus GN=Dcun1d5 PE=1 SV=1 98 329 2.0E-34
sp|Q6PH85|DCNL2_HUMAN DCN1-like protein 2 OS=Homo sapiens GN=DCUN1D2 PE=1 SV=1 58 329 3.0E-34
sp|Q96GG9|DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens GN=DCUN1D1 PE=1 SV=1 58 329 7.0E-34
sp|Q54GP1|DCN1L_DICDI DCN1-like protein 1 OS=Dictyostelium discoideum GN=DDB_G0290025 PE=3 SV=1 52 329 1.0E-33
sp|Q5ZKU1|DCNL1_CHICK DCN1-like protein 1 OS=Gallus gallus GN=DCUN1D1 PE=2 SV=1 58 329 3.0E-33
sp|Q9QZ73|DCNL1_MOUSE DCN1-like protein 1 OS=Mus musculus GN=Dcun1d1 PE=1 SV=1 58 329 5.0E-33
sp|Q5RDF9|DCNL5_PONAB DCN1-like protein 5 OS=Pongo abelii GN=DCUN1D5 PE=2 SV=1 98 329 9.0E-33
sp|Q8IWE4|DCNL3_HUMAN DCN1-like protein 3 OS=Homo sapiens GN=DCUN1D3 PE=1 SV=1 82 327 5.0E-31
sp|Q5R9G1|DCNL3_PONAB DCN1-like protein 3 OS=Pongo abelii GN=DCUN1D3 PE=2 SV=1 82 327 5.0E-31
sp|Q5AWS1|DCN1_EMENI Defective in cullin neddylation protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dcn1 PE=3 SV=1 116 329 7.0E-31
sp|Q5E9V1|DCNL3_BOVIN DCN1-like protein 3 OS=Bos taurus GN=DCUN1D3 PE=2 SV=1 82 327 8.0E-31
sp|Q8K0V2|DCNL3_MOUSE DCN1-like protein 3 OS=Mus musculus GN=Dcun1d3 PE=2 SV=1 82 327 1.0E-30
sp|Q6C0B6|DCN1_YARLI Defective in cullin neddylation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DCN1 PE=3 SV=1 58 329 1.0E-30
sp|Q4V8B2|DCNL3_RAT DCN1-like protein 3 OS=Rattus norvegicus GN=Dcun1d3 PE=2 SV=1 82 327 1.0E-30
sp|Q92564|DCNL4_HUMAN DCN1-like protein 4 OS=Homo sapiens GN=DCUN1D4 PE=1 SV=2 101 334 2.0E-30
sp|Q8CCA0|DCNL4_MOUSE DCN1-like protein 4 OS=Mus musculus GN=Dcun1d4 PE=2 SV=1 129 334 3.0E-30
sp|Q5ADL9|DCN1_CANAL Defective in cullin neddylation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCN1 PE=3 SV=1 63 327 3.0E-30
sp|Q5RHX6|DCNL4_DANRE DCN1-like protein 4 OS=Danio rerio GN=dcun1d4 PE=3 SV=2 120 329 4.0E-30
sp|A4IHK8|DCNL3_XENTR DCN1-like protein 3 OS=Xenopus tropicalis GN=dcun1d3 PE=2 SV=1 64 327 2.0E-28
sp|Q6DFA1|DCNL3_XENLA DCN1-like protein 3 OS=Xenopus laevis GN=dcun1d3 PE=2 SV=1 111 327 5.0E-28
sp|Q52DM9|DCN1_MAGO7 Defective in cullin neddylation protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCN1 PE=3 SV=1 61 332 5.0E-25
sp|Q9VUQ8|DCN1L_DROME DCN1-like protein OS=Drosophila melanogaster GN=CG7427 PE=2 SV=2 109 329 9.0E-24
sp|Q86JM4|DCN1M_DICDI DCN1-like protein 2 OS=Dictyostelium discoideum GN=DDB_G0272016 PE=3 SV=1 117 329 5.0E-23
sp|Q9U3C8|DCN1_CAEEL Defective in cullin neddylation protein 1 OS=Caenorhabditis elegans GN=dcn-1 PE=1 SV=2 60 329 7.0E-22
sp|Q12395|DCN1_YEAST Defective in cullin neddylation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCN1 PE=1 SV=1 58 326 2.0E-21
sp|Q6FJR2|DCN1_CANGA Defective in cullin neddylation protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCN1 PE=3 SV=1 58 327 2.0E-20
sp|Q750Y3|DCN1_ASHGO Defective in cullin neddylation protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCN1 PE=3 SV=2 54 330 3.0E-20
sp|Q60YT5|DCN1_CAEBR Defective in cullin neddylation protein 1 OS=Caenorhabditis briggsae GN=dcn-1 PE=3 SV=3 41 329 1.0E-19
sp|Q8WZK4|DCN1_SCHPO Defective in cullin neddylation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcn1 PE=3 SV=1 63 332 4.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|035740
MNKDRAAFLGLNFVFHHPALLTAFFVAFLSGVFIVAWADTGPKKSFLLSIIMPGKNDENMANFVAITGSTTREAK
KYLEKYKRLDAAMDAYYHENNDSSPSSRQTSNNRPASTSSLTTLFNHYKDPDGDEITVDGTIKLCEDLGVDPEDV
VMLAIAYELKSPRMGTWTKQGWIDGWKALRCDNIASMKAVMSELRSRLARDPEYFKNVYNHSFEFARSEGQRSLA
LETAQGLWSLLLPHGLQGGALSHLMTSSMDSDNDVEMDGVERGWTQTQTQLWFDFLTAKGLKGISRDTWQMFREF
VRTIDSRFSNHDQESAWPSTFDEFVEYAKGTGAS*
Coding >Agabi119p4|035740
ATGAACAAAGACCGCGCCGCGTTTCTCGGTCTGAATTTCGTTTTTCATCATCCAGCTTTATTGACTGCGTTCTTC
GTCGCCTTTTTGTCTGGTGTTTTCATTGTTGCATGGGCCGACACAGGACCTAAAAAGAGTTTTCTGCTTTCAATT
ATCATGCCAGGCAAGAACGATGAAAATATGGCAAATTTTGTCGCCATCACAGGTTCAACGACCAGAGAGGCAAAA
AAGTACTTGGAGAAGTACAAGCGTCTCGATGCCGCCATGGACGCTTACTATCATGAAAATAATGACTCCTCGCCA
TCGAGCAGACAAACGTCCAACAATCGTCCTGCATCTACAAGTTCACTGACAACCCTTTTCAATCATTACAAAGAT
CCCGATGGTGACGAGATTACTGTTGATGGCACGATCAAGCTCTGCGAAGATTTGGGGGTGGATCCAGAGGATGTA
GTTATGCTGGCTATCGCATACGAACTAAAATCACCGCGGATGGGGACCTGGACGAAGCAAGGATGGATCGATGGC
TGGAAAGCGCTACGGTGTGACAATATTGCCTCCATGAAAGCTGTTATGTCCGAGCTACGTTCCAGGCTTGCACGA
GATCCGGAATACTTTAAGAACGTTTACAATCACTCCTTTGAGTTCGCTCGCAGTGAAGGACAGCGGAGTTTAGCT
CTCGAAACAGCTCAGGGGCTCTGGAGCCTTCTGCTTCCTCATGGCCTACAGGGCGGCGCTTTGTCCCACCTAATG
ACTTCTTCGATGGACTCGGATAATGATGTCGAGATGGATGGTGTAGAGCGGGGTTGGACGCAAACACAAACACAA
CTTTGGTTTGATTTCCTCACTGCGAAAGGGTTAAAAGGTATCAGCCGGGATACGTGGCAAATGTTTCGCGAATTC
GTCCGTACTATCGACTCACGGTTTAGCAATCACGACCAGGAATCCGCCTGGCCGTCGACTTTTGATGAATTTGTT
GAATACGCAAAAGGAACAGGAGCGAGCTGA
Transcript >Agabi119p4|035740
ATGAACAAAGACCGCGCCGCGTTTCTCGGTCTGAATTTCGTTTTTCATCATCCAGCTTTATTGACTGCGTTCTTC
GTCGCCTTTTTGTCTGGTGTTTTCATTGTTGCATGGGCCGACACAGGACCTAAAAAGAGTTTTCTGCTTTCAATT
ATCATGCCAGGCAAGAACGATGAAAATATGGCAAATTTTGTCGCCATCACAGGTTCAACGACCAGAGAGGCAAAA
AAGTACTTGGAGAAGTACAAGCGTCTCGATGCCGCCATGGACGCTTACTATCATGAAAATAATGACTCCTCGCCA
TCGAGCAGACAAACGTCCAACAATCGTCCTGCATCTACAAGTTCACTGACAACCCTTTTCAATCATTACAAAGAT
CCCGATGGTGACGAGATTACTGTTGATGGCACGATCAAGCTCTGCGAAGATTTGGGGGTGGATCCAGAGGATGTA
GTTATGCTGGCTATCGCATACGAACTAAAATCACCGCGGATGGGGACCTGGACGAAGCAAGGATGGATCGATGGC
TGGAAAGCGCTACGGTGTGACAATATTGCCTCCATGAAAGCTGTTATGTCCGAGCTACGTTCCAGGCTTGCACGA
GATCCGGAATACTTTAAGAACGTTTACAATCACTCCTTTGAGTTCGCTCGCAGTGAAGGACAGCGGAGTTTAGCT
CTCGAAACAGCTCAGGGGCTCTGGAGCCTTCTGCTTCCTCATGGCCTACAGGGCGGCGCTTTGTCCCACCTAATG
ACTTCTTCGATGGACTCGGATAATGATGTCGAGATGGATGGTGTAGAGCGGGGTTGGACGCAAACACAAACACAA
CTTTGGTTTGATTTCCTCACTGCGAAAGGGTTAAAAGGTATCAGCCGGGATACGTGGCAAATGTTTCGCGAATTC
GTCCGTACTATCGACTCACGGTTTAGCAATCACGACCAGGAATCCGCCTGGCCGTCGACTTTTGATGAATTTGTT
GAATACGCAAAAGGAACAGGAGCGAGCTGA
Gene >Agabi119p4|035740
ATGAACAAAGACCGCGCCGCGTTTCTCGGTCTGAATTTCGTTTTTCATCATCCAGCTTTATTGACTGCGTTCTTC
GTCGCCTTTTTGTCTGGTGTTTTCATTGTTGCATGGGCCGACACAGGACCTGTGAGCAACACCTGAATTTATTTA
GAGCTAGCGATTCACGTGTGCTGCTTTCTGCCCTGATATGGCGATTCTCCATTCCTCGACTGCCAACTTCAGAAA
AAGAGTTTTCTGCTTTCAATTATCATGCCAGGCAAGAACGATGAAAATATGGCAAATTTTGTCGCCATCACAGGT
TCAACGTGAGTACCACGATGCCTGTGCTGACGGTCTCCCTGTTGATCTTCAATACTCGGGTTAAAGGACCAGAGA
GGCAAAAAAGTACTTGGAGAAGTACAAGCGTCTCGATGCCGCCATGGACGCTTACTATCATGAAAATAATGACTC
CTCGCCATCGAGCAGACAAACGTCCAACAATCGTCCTGCATCTACAAGTTCACTGACAACCCTTTTCAATCATTA
CAAAGGTCTGATCTTCGATCGAGAGTGGAAACAAACCTCCGACGCTCATTTGACAATGTCTACTTTCTCTTTAAA
GATCCCGATGGTGACGAGATTACTGTTGATGGCACGATCAAGCTCTGCGAAGATTTGGGGGTGGATCCAGAGGAT
GTAGTTATGCTGGCTATCGCATACGAACTAAAATCACCGCGGATGGGGACCTGGACGAAGCAAGGATGGATCGAT
GGCTGGAAAGCGCTACGGTATGCATCTCTTCTGCTGCCGCTTCATCAGGACGCTGAACCTACGATCTTCCAATAT
GATTTAGGTGTGACAATATTGCCTCCATGAAAGCTGTTATGTCCGAGCTACGTTCCAGGCTTGCACGAGATCCGG
AATACTTTAAGAACGTTTACAATCACTCCTTTGAGTTCGCTCGCAGTGAAGGACAGCGGAGTTTAGGTGAGTCGA
TGCTGGCAATTTGATCAATAATCTCACAAATGACCGTCCGGAAGCTCTCGAAACAGCTCAGGGGCTCTGGAGCCT
TCTGCTTCCTCATGGCCTACAGGGCGGCGCTTTGTCCCACCTAATGACTTCTTCGATGGACTCGGATAATGATGT
CGAGATGGATGGTGTAGAGCGGGGTTGGACGCAAACACAAACACAACTTTGGTTTGATTTCCTCACTGCGAAAGG
GTTAAAAGGTATCAGCCGGGATACGTGGCAAATGGTGGGTGAACAAAGTGAACATCTTCAACTCGACCGTATATT
CAATGCCATCTGTTTACCAAGTTTCGCGAATTCGTCCGTACTATCGACTCACGGTTTAGCAATCACGACCAGGAA
TGTAAGCATCATTTGCAAATGCCTAATAAGCCTTATACCGAGTGATGATGTTAGCCGCCTGGCCGTCGACTTTTG
ATGAATTTGTTGAATACGCAAAAGGAACAGGAGCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail