Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|035670
Gene name
Locationscaffold_13:540427..542897
Strand-
Gene length (bp)2470
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16862 Glyco_hydro_79C Glycosyl hydrolase family 79 C-terminal beta domain 7.9E-18 461 571

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A2QEQ6|GUS79_ASPNC Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g11890 PE=1 SV=1 88 574 6.0E-09
sp|Q7SFB0|GUS79_NEUCR Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00937 PE=1 SV=1 88 478 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|035670
MVSWKLAFGLSLSAQAFVQGVTIHHVPGQDPFAATTATAAAAAYTGAAAYDPTTLTPPPVPTNLNKNFQLSVIPG
GVPGLSIKVPGRFFGFSVEMSVVEQLFGKNSTFIQVPFLNLMANILSRSGSFMIRVGGNTQETAEVTHDFDAFPN
GRVMEKDLSGVTNPTQTPPLLITPGYLALLGNISSLMNIDWYLGIPFFDVANLKLDIVELGQQYLGKHLIGIEVG
NEPDFYVSHGHRTEGYGPPNYVDEFGQVVSAMNNDANAANRKLLIGPNVDLNWNIQDVWDTGFVDRYNENLVALA
VERYPTDNCFAQFGSGTPRNAQDEFPNYLTHQSGQDMAGPYLASTAFAQTKGKPFLMFETNTASCGGFAGISDVF
GAALWAVDYAMTMAHSNFSGIMFHFGGQNVFYNPFTPPPTNQSAFHQWTVGPIYYSALVVAEAIGSSGNAQVIDL
VANGGELLTPAYAIYENGQPVRMLLVNFVDDPSGNSDITASISVGGGQTGVPGATPASVKVKYLRAGSVSQKGNY
TWAGQTWGDHFFSDGRPVGEEQIETVNCDQNAGVCNIPVHAPSVALVFLSDDAQTENSGQPSTTFATTARTKTFN
TASVDDAVLATSNGDKDAGSKLGSTSKGSANTAQGISAHLPGLSVVLSLALGAVILSGRRW*
Coding >Agabi119p4|035670
ATGGTTTCGTGGAAATTGGCCTTCGGCTTGAGTCTGTCCGCCCAGGCTTTTGTCCAGGGCGTAACTATACACCAT
GTACCAGGTCAAGATCCGTTCGCAGCGACGACAGCAACTGCTGCTGCTGCTGCCTATACAGGAGCCGCTGCTTAC
GACCCCACCACCCTCACTCCTCCACCAGTCCCTACCAATCTTAATAAAAACTTCCAACTGTCGGTCATTCCTGGC
GGCGTCCCAGGCCTCTCAATCAAAGTACCTGGGCGTTTCTTTGGGTTTTCTGTAGAAATGTCAGTCGTTGAACAA
CTCTTTGGGAAAAACTCCACTTTCATTCAGGTTCCTTTCCTGAACCTGATGGCCAACATATTGTCACGTTCAGGA
TCCTTCATGATTCGAGTGGGTGGTAACACTCAAGAAACTGCCGAGGTGACCCATGACTTTGATGCCTTTCCCAAT
GGTCGTGTTATGGAGAAAGACTTGAGCGGTGTTACCAATCCCACTCAAACGCCGCCTCTTCTCATTACTCCCGGA
TACTTGGCGCTACTGGGTAATATCTCTTCGCTTATGAACATCGACTGGTACCTTGGTATCCCATTCTTTGATGTA
GCCAATCTCAAACTAGATATTGTCGAGTTAGGACAACAATACCTCGGAAAACACCTTATTGGTATTGAAGTCGGC
AATGAACCCGATTTCTATGTCAGCCATGGTCATCGTACTGAAGGTTACGGTCCACCAAATTATGTGGATGAATTC
GGCCAAGTAGTCAGTGCGATGAATAACGATGCCAATGCCGCCAATCGAAAACTTCTTATCGGGCCAAACGTAGAC
TTGAATTGGAACATCCAAGACGTTTGGGACACTGGCTTCGTCGATAGATATAATGAGAATCTTGTTGCCCTTGCT
GTTGAAAGATATCCAACCGACAACTGTTTTGCCCAGTTCGGTTCAGGAACCCCAAGAAATGCTCAGGACGAATTC
CCAAATTATCTTACTCATCAATCTGGTCAGGATATGGCGGGCCCTTATCTTGCTTCCACAGCCTTTGCTCAGACG
AAAGGGAAGCCGTTTTTGATGTTTGAAACCAACACGGCTTCCTGTGGAGGTTTCGCTGGAATTTCTGATGTTTTC
GGTGCTGCTCTCTGGGCTGTGGATTATGCTATGACCATGGCGCATAGCAACTTCAGTGGCATAATGTTCCATTTT
GGTGGTCAGAACGTGTTTTACAACCCTTTCACTCCTCCTCCTACTAACCAATCCGCTTTCCACCAGTGGACTGTG
GGACCCATCTATTACTCTGCTCTTGTTGTGGCTGAGGCTATTGGATCTTCCGGCAATGCTCAAGTCATCGACCTT
GTAGCAAACGGTGGAGAACTTCTCACTCCGGCTTACGCGATCTACGAGAATGGACAACCTGTTCGAATGCTACTA
GTCAATTTTGTTGATGACCCTTCTGGAAACAGCGATATCACCGCTAGTATCTCGGTCGGTGGTGGCCAGACTGGT
GTTCCTGGTGCTACACCCGCTTCGGTCAAAGTCAAATATCTACGTGCAGGGTCTGTATCGCAGAAGGGTAACTAT
ACCTGGGCTGGTCAGACTTGGGGTGATCACTTCTTTTCCGATGGTCGCCCCGTTGGCGAAGAGCAAATCGAGACT
GTCAATTGTGATCAGAATGCTGGCGTTTGCAATATTCCTGTCCACGCCCCATCAGTCGCACTCGTTTTCCTTAGT
GATGATGCGCAGACTGAAAATAGTGGTCAACCCTCTACGACTTTCGCGACTACTGCAAGAACGAAGACTTTCAAC
ACGGCATCGGTTGATGATGCAGTATTGGCCACATCTAATGGAGATAAGGACGCAGGATCTAAATTGGGTAGCACG
AGTAAAGGGAGTGCTAATACTGCTCAAGGAATTTCAGCACATCTACCTGGATTGAGTGTTGTATTGTCTTTGGCG
CTGGGTGCTGTGATCTTGTCTGGAAGGAGATGGTAA
Transcript >Agabi119p4|035670
ATGGTTTCGTGGAAATTGGCCTTCGGCTTGAGTCTGTCCGCCCAGGCTTTTGTCCAGGGCGTAACTATACACCAT
GTACCAGGTCAAGATCCGTTCGCAGCGACGACAGCAACTGCTGCTGCTGCTGCCTATACAGGAGCCGCTGCTTAC
GACCCCACCACCCTCACTCCTCCACCAGTCCCTACCAATCTTAATAAAAACTTCCAACTGTCGGTCATTCCTGGC
GGCGTCCCAGGCCTCTCAATCAAAGTACCTGGGCGTTTCTTTGGGTTTTCTGTAGAAATGTCAGTCGTTGAACAA
CTCTTTGGGAAAAACTCCACTTTCATTCAGGTTCCTTTCCTGAACCTGATGGCCAACATATTGTCACGTTCAGGA
TCCTTCATGATTCGAGTGGGTGGTAACACTCAAGAAACTGCCGAGGTGACCCATGACTTTGATGCCTTTCCCAAT
GGTCGTGTTATGGAGAAAGACTTGAGCGGTGTTACCAATCCCACTCAAACGCCGCCTCTTCTCATTACTCCCGGA
TACTTGGCGCTACTGGGTAATATCTCTTCGCTTATGAACATCGACTGGTACCTTGGTATCCCATTCTTTGATGTA
GCCAATCTCAAACTAGATATTGTCGAGTTAGGACAACAATACCTCGGAAAACACCTTATTGGTATTGAAGTCGGC
AATGAACCCGATTTCTATGTCAGCCATGGTCATCGTACTGAAGGTTACGGTCCACCAAATTATGTGGATGAATTC
GGCCAAGTAGTCAGTGCGATGAATAACGATGCCAATGCCGCCAATCGAAAACTTCTTATCGGGCCAAACGTAGAC
TTGAATTGGAACATCCAAGACGTTTGGGACACTGGCTTCGTCGATAGATATAATGAGAATCTTGTTGCCCTTGCT
GTTGAAAGATATCCAACCGACAACTGTTTTGCCCAGTTCGGTTCAGGAACCCCAAGAAATGCTCAGGACGAATTC
CCAAATTATCTTACTCATCAATCTGGTCAGGATATGGCGGGCCCTTATCTTGCTTCCACAGCCTTTGCTCAGACG
AAAGGGAAGCCGTTTTTGATGTTTGAAACCAACACGGCTTCCTGTGGAGGTTTCGCTGGAATTTCTGATGTTTTC
GGTGCTGCTCTCTGGGCTGTGGATTATGCTATGACCATGGCGCATAGCAACTTCAGTGGCATAATGTTCCATTTT
GGTGGTCAGAACGTGTTTTACAACCCTTTCACTCCTCCTCCTACTAACCAATCCGCTTTCCACCAGTGGACTGTG
GGACCCATCTATTACTCTGCTCTTGTTGTGGCTGAGGCTATTGGATCTTCCGGCAATGCTCAAGTCATCGACCTT
GTAGCAAACGGTGGAGAACTTCTCACTCCGGCTTACGCGATCTACGAGAATGGACAACCTGTTCGAATGCTACTA
GTCAATTTTGTTGATGACCCTTCTGGAAACAGCGATATCACCGCTAGTATCTCGGTCGGTGGTGGCCAGACTGGT
GTTCCTGGTGCTACACCCGCTTCGGTCAAAGTCAAATATCTACGTGCAGGGTCTGTATCGCAGAAGGGTAACTAT
ACCTGGGCTGGTCAGACTTGGGGTGATCACTTCTTTTCCGATGGTCGCCCCGTTGGCGAAGAGCAAATCGAGACT
GTCAATTGTGATCAGAATGCTGGCGTTTGCAATATTCCTGTCCACGCCCCATCAGTCGCACTCGTTTTCCTTAGT
GATGATGCGCAGACTGAAAATAGTGGTCAACCCTCTACGACTTTCGCGACTACTGCAAGAACGAAGACTTTCAAC
ACGGCATCGGTTGATGATGCAGTATTGGCCACATCTAATGGAGATAAGGACGCAGGATCTAAATTGGGTAGCACG
AGTAAAGGGAGTGCTAATACTGCTCAAGGAATTTCAGCACATCTACCTGGATTGAGTGTTGTATTGTCTTTGGCG
CTGGGTGCTGTGATCTTGTCTGGAAGGAGATGGTAA
Gene >Agabi119p4|035670
ATGGTTTCGTGGAAATTGGCCTTCGGCTTGAGTCTGTCCGCCCAGGCTTTTGTCCAGGGCGTAACTATACACCAT
GTACCAGGTCAAGATCCGTTCGCAGCGACGACAGCAACTGCTGCTGCTGCTGCCTATACAGGAGCCGCTGCTTAC
GACCCCACCACCCTCACTCCTCCACCAGTCCCTACCAATCTTAATAAAAACTTCCAACTGTCGGTCATTCCTGGC
GGCGTCCCAGGCCTCTCAATCAAAGTACCTGGGCGTTTCTTTGGGTTTTCTGTAGAAATGTCAGTCGTTGAACAA
CTCTGTGAGTTCTGTCCTACCTACATTCTGTCTCACTACTGATGACGCTATTGAAGTTGGGAAAAACTCGTGCGT
TTCTATTCTACAGTTTGCCTGCCCTCCCTCTCAACACTAGGTTCCTCTTTAGCACTTTCATTCAGGTTCCTTTCC
TGAACCTGATGGCCAACATATTGTCACGTTCAGGATCCTTCATGATTCGAGTGGGTGGTAACACTCAAGAAACTG
CCGAGGTGACCCATGACTTTGATGCCTTTCCCAATGGTCGTGTTATGGAGAAAGACTTGAGCGGTGTTACCAATC
CCGTAAGTTATCATTGTAAAAGTACTTGAATACTGATCCCATACAATTCTAATAGACTCAAACGCCGCCTCTTCT
CATTACTCCCGGATACTTGGCGCTACTGGGTAATATCTCTTCGCTTATGAACATCGACTGGTACCTTGGTATGGC
TCTGAGCTCTTCCCACGGCGGCTTGTACTTACCTTGTTATTTTTCAGGTATCCCATTCTTTGATGTAGCCAATCT
CAAACTAGATATTGTCGAGTTAGGACAACAATACCTCGGAAAACACCTTATTGGTATTGAAGTCGGCAATGAACC
CGATTTCTATGTCAGCCATGGTCATCGTACTGAAGGTTACGGTCCACCAAATTATGTGGATGAATTCGGCCAAGT
AGTCAGTGCGATGAATAACGATGCCAATGCCGCCAATCGAAAACTTCTTATCGGGCCAAACGTAGACTTGAATTG
GAACATCCAAGACGTTTGGGACACTGGCTTCGTCGATAGATATAATGAGAATCTTGTTGCCCTTGCTGTTGAAAG
GTCCGTCCTTCGTTTATCCTTCCTGATCTTCAATCAATGTCGCCTTGGCAGATATCCAACCGACAACTGTTTTGC
CCAGTTCGGTTCAGGAACCCCAAGAAATGCTCAGGACGAATTCCCAAATTATCTTACTCATCAATCTGGTCAGGA
TATGGCGGGCCCTTATCTTGCTTCCACAGCCTTTGCTCAGACGAAAGGGAAGCCGTTTTTGATGTTTGAAACCAA
CACGGCTTCCTGTGGAGGTTTCGCTGGAATTTCTGATGTTTTCGGTGCTGCTCTCTGGGCTGTGGATTATGCTAT
GACCATGGCGCATAGCAACTTCAGTGGCATAATGTTCCATTTTGGTGGTCAGAACGTGTTTTACAACGTATGTCG
ATTGCATTTCAAATAGTTGATCTGATGACTGATCTGCTGTGTTCAGCCTTTCACTCGTAAGCCCTCGCTAGAATG
CACTTGTCGATAGAAAAACTGAGATGATTTTCAGCTCCTCCTACTAACCAATCCGCTTTCCACCAGTGGACTGTG
GGACCCATCTATTACTCTGCTCTTGTTGTGGCTGAGGCTATTGGATCTTCCGGCAATGCTCAAGTCATCGACCTT
GTAGCAAACGGTGGAGAACTTCTCACTCCGGCTTACGCGATCTACGAGAATGGACAACCTGTTCGAATGCTACTA
GTCAATTTTGTTGATGACCCTTCTGGAAACAGCGATATCACCGCTAGTATCTCGGTCGGTGGTGGCCAGACTGGT
GTTCCTGGTGCTACACCCGCTTCGGTCAAAGTCAAGTGAGCCAATAACTTTTGGCTCTATTTCCTGAGTTAGAGA
GTTAAACTTTATAACTACAGATATCTACGTGCAGGGTCTGTATCGCAGAAGGGTAACTATACCTGGGCTGGTCAG
GTAGGTTACTTTGATTACCGGGCTCAAGCTGTTTGTTGACTTTTTTCAGACTTGGGGTGATCACTTCTTTTCCGA
TGGTCGCCCCGTTGGCGAAGAGCAAATCGAGACTGTCAATTGTGATCAGAATGCTGGCGTTTGCAATATTCCTGT
CCACGCCCCATCAGTCGCACTCGTTTTCCTTAGTGATGATGCGCAGACTGAAAATAGTGGTCAACCCTCTACGAC
TTTCGCGACTACTGCAAGAACGAAGACTTTCAACACGGCATCGGTTGATGATGCAGTATTGGCCACATCTAATGG
AGATAAGGACGCAGGATCTAAATTGGGTAGCACGAGTAAAGGGAGTGCTAATACTGCTCAAGGAATTTCAGCACA
TCTACCTGGATTGAGTGTTGTATTGTCTTTGGCGCTGGGTGCTGTGATCTTGTCTGGAAGGAGATGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail