Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|035430
Gene name
Locationscaffold_13:466829..467374
Strand-
Gene length (bp)545
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 1.5E-08 24 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02366|NDUA6_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Bos taurus GN=NDUFA6 PE=1 SV=2 15 121 1.0E-22
sp|Q0MQA3|NDUA6_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Pongo pygmaeus GN=NDUFA6 PE=2 SV=3 15 121 3.0E-22
sp|Q9CQZ5|NDUA6_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Mus musculus GN=Ndufa6 PE=1 SV=1 15 121 8.0E-22
sp|Q0MQA5|NDUA6_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Pan troglodytes GN=NDUFA6 PE=2 SV=3 15 121 4.0E-21
sp|Q0MQA4|NDUA6_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Gorilla gorilla gorilla GN=NDUFA6 PE=2 SV=3 15 121 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02366|NDUA6_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Bos taurus GN=NDUFA6 PE=1 SV=2 15 121 1.0E-22
sp|Q0MQA3|NDUA6_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Pongo pygmaeus GN=NDUFA6 PE=2 SV=3 15 121 3.0E-22
sp|Q9CQZ5|NDUA6_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Mus musculus GN=Ndufa6 PE=1 SV=1 15 121 8.0E-22
sp|Q0MQA5|NDUA6_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Pan troglodytes GN=NDUFA6 PE=2 SV=3 15 121 4.0E-21
sp|Q0MQA4|NDUA6_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Gorilla gorilla gorilla GN=NDUFA6 PE=2 SV=3 15 121 4.0E-21
sp|P42114|NDUA6_NEUCR NADH-ubiquinone oxidoreductase 14.8 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo14.8 PE=1 SV=3 1 121 4.0E-21
sp|P56556|NDUA6_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Homo sapiens GN=NDUFA6 PE=1 SV=3 15 121 7.0E-21
sp|Q9LHI0|NDUA6_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Arabidopsis thaliana GN=At3g12260 PE=2 SV=1 5 117 8.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|035430
MSTIPSRLSRVARPSINSSESRSRVLQLYRDWYRSAPEICTLYALNHSPTYIRHSLRLKFEKNRYVTDQRAIDIL
IHKSRLELQETMNVWKQNDHVLGILLANSEEEGPKTFLQKFYEGRDEEAVAPAASGVH*
Coding >Agabi119p4|035430
ATGTCGACAATACCCTCTCGTCTTTCTAGAGTAGCTCGTCCCTCTATCAATTCTTCCGAATCTCGTTCTCGCGTT
CTCCAACTCTACCGCGACTGGTACCGTTCCGCTCCAGAAATCTGCACCCTCTACGCCCTAAACCACTCTCCCACC
TACATCCGTCACTCCCTCCGTCTCAAATTCGAAAAAAACCGCTATGTGACGGATCAAAGAGCGATTGACATTTTG
ATTCATAAATCTCGATTGGAATTACAAGAGACTATGAATGTGTGGAAACAGAATGATCATGTTTTAGGGATTTTG
TTGGCTAATTCTGAAGAGGAGGGGCCAAAAACGTTTTTGCAAAAGTTTTATGAAGGGAGAGATGAAGAGGCTGTT
GCGCCTGCTGCTTCGGGTGTACATTAG
Transcript >Agabi119p4|035430
ATGTCGACAATACCCTCTCGTCTTTCTAGAGTAGCTCGTCCCTCTATCAATTCTTCCGAATCTCGTTCTCGCGTT
CTCCAACTCTACCGCGACTGGTACCGTTCCGCTCCAGAAATCTGCACCCTCTACGCCCTAAACCACTCTCCCACC
TACATCCGTCACTCCCTCCGTCTCAAATTCGAAAAAAACCGCTATGTGACGGATCAAAGAGCGATTGACATTTTG
ATTCATAAATCTCGATTGGAATTACAAGAGACTATGAATGTGTGGAAACAGAATGATCATGTTTTAGGGATTTTG
TTGGCTAATTCTGAAGAGGAGGGGCCAAAAACGTTTTTGCAAAAGTTTTATGAAGGGAGAGATGAAGAGGCTGTT
GCGCCTGCTGCTTCGGGTGTACATTAG
Gene >Agabi119p4|035430
ATGTCGACAATACCCTCTCGTCTTTCTAGAGTAGCTCGTCCCTCTATCAATTCTTCCGAATCTCGTTCTCGCGTT
CTCCAACTCTACCGCGACTGGTACCGTTCCGTACGTTTCTCTCTCCTCTCCCCCCCCTCTCTCTTCTCTCTCTCT
TCATCCTTTTTTACACCACACAAAACACAGGCTCCAGAAATCTGCACCCTCTACGCCCTAAACCACTCTCCCACC
TACATCCGTCACTCCCTCCGTCTCAAATTCGAAAAAAACCGCTATGTGACGGATCAAAGAGCGATTGACATTTTG
ATTCATAAATCTCGATTGGAATTACAAGAGACTATGAATGTGTGGAAACAGAATGATCATGTTTTAGGGATTTTG
TTGGCTAATTCTGAAGAGGAGGGGCCAAAAACGTTTTTGCAAAAGTTTTATGAAGGTGTGTTGGTGTTGTTGCTT
GGAGGAAGGGAGGTAGGGTTACTGACGAGTTTTTATTTATTTTTTTAGGGAGAGATGAAGAGGCTGTTGCGCCTG
CTGCTTCGGGTGTACATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail