Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|034660
Gene name
Locationscaffold_13:313131..316828
Strand-
Gene length (bp)3697
Transcript length (bp)3132
Coding sequence length (bp)3132
Protein length (aa) 1044

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 2.0E-130 171 665
PF02358 Trehalose_PPase Trehalose-phosphatase 1.2E-20 732 898

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.16c PE=1 SV=1 82 862 4.0E-124
sp|Q9UUI7|TPSY_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.05 PE=1 SV=1 143 898 2.0E-121
sp|P38427|TSL1_YEAST Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSL1 PE=1 SV=1 162 867 2.0E-111
sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 171 903 3.0E-102
sp|Q54NU9|TPSB_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum GN=tpsB PE=3 SV=1 175 899 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.16c PE=1 SV=1 82 862 4.0E-124
sp|Q9UUI7|TPSY_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.05 PE=1 SV=1 143 898 2.0E-121
sp|P38427|TSL1_YEAST Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSL1 PE=1 SV=1 162 867 2.0E-111
sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 171 903 3.0E-102
sp|Q54NU9|TPSB_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum GN=tpsB PE=3 SV=1 175 899 1.0E-98
sp|Q9SYM4|TPS1_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana GN=TPS1 PE=1 SV=1 172 898 2.0E-96
sp|P38426|TPS3_YEAST Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS3 PE=1 SV=3 41 869 3.0E-96
sp|Q9FZ57|TPS2_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana GN=TPS2 PE=3 SV=1 162 898 8.0E-92
sp|Q9T079|TPS4_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 4 OS=Arabidopsis thaliana GN=TPS4 PE=3 SV=1 159 898 1.0E-85
sp|O14145|TPS2_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps2 PE=3 SV=1 236 902 3.0E-83
sp|Q9SHG0|TPS3_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 3 OS=Arabidopsis thaliana GN=TPS3 PE=3 SV=3 201 898 7.0E-83
sp|O74932|TPS1_YARLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPS1 PE=2 SV=1 207 669 2.0E-78
sp|P40387|TPS1_SCHPO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps1 PE=1 SV=2 171 673 3.0E-78
sp|Q00764|TPS1_YEAST Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS1 PE=1 SV=2 128 666 6.0E-78
sp|O94213|TPS1_PICAN Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pichia angusta GN=TPS1 PE=3 SV=1 171 669 8.0E-78
sp|P78875|TPP1_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpp1 PE=1 SV=2 190 963 1.0E-77
sp|Q07158|TPS1_KLULA Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPS1 PE=3 SV=1 149 671 1.0E-76
sp|P31688|TPS2_YEAST Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS2 PE=1 SV=3 221 903 4.0E-76
sp|O80738|TPS10_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana GN=TPS10 PE=2 SV=1 189 898 8.0E-76
sp|Q96WK6|TPS1_ZYGRO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Zygosaccharomyces rouxii GN=TPS1 PE=2 SV=1 149 666 7.0E-75
sp|Q00075|TPSA_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger GN=tpsA PE=3 SV=1 209 673 1.0E-73
sp|O23617|TPS5_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana GN=TPS5 PE=1 SV=2 185 862 2.0E-73
sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana GN=TPS9 PE=2 SV=1 194 930 2.0E-71
sp|O59921|TPS1_EMENI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpsA PE=3 SV=1 209 668 2.0E-71
sp|Q00217|TPSB_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger GN=tpsB PE=3 SV=1 171 663 3.0E-71
sp|Q92410|TPS1_CANAL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPS1 PE=2 SV=1 171 677 4.0E-70
sp|Q94AH8|TPS6_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana GN=TPS6 PE=1 SV=2 162 862 2.0E-69
sp|Q9LMI0|TPS7_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana GN=TPS7 PE=1 SV=1 189 862 2.0E-68
sp|G4RK44|TPSP_THETK Bifunctional trehalose-6-phosphate synthase/phosphatase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=tpsp PE=1 SV=1 170 903 6.0E-68
sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana GN=TPS8 PE=2 SV=1 189 930 3.0E-66
sp|Q9ZV48|TPS11_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana GN=TPS11 PE=2 SV=1 206 862 1.0E-64
sp|Q8SSL2|TPS1_ENCCU Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Encephalitozoon cuniculi (strain GB-M1) GN=TPS1 PE=1 SV=1 169 633 2.0E-52
sp|Q93JY3|GGPS_PSEAG Glucosylglycerol-phosphate synthase OS=Pseudomonas anguilliseptica GN=ggpS PE=3 SV=2 209 666 6.0E-43
sp|A0R4M9|OTSA_MYCS2 Trehalose-phosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=otsA PE=1 SV=1 169 664 1.0E-41
sp|A0QAK7|OTSA_MYCA1 Trehalose-phosphate synthase OS=Mycobacterium avium (strain 104) GN=otsA PE=3 SV=1 169 664 1.0E-40
sp|A1KPH5|OTSA_MYCBP Trehalose-phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=otsA PE=3 SV=1 169 670 1.0E-40
sp|Q7TWE1|OTSA_MYCBO Trehalose-phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=otsA PE=3 SV=1 169 670 1.0E-40
sp|Q743L8|OTSA_MYCPA Trehalose-phosphate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=otsA PE=3 SV=1 169 664 2.0E-40
sp|Q50167|OTSA_MYCLE Trehalose-phosphate synthase OS=Mycobacterium leprae (strain TN) GN=otsA PE=3 SV=1 169 669 4.0E-40
sp|P9WN11|OTSA_MYCTU Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=otsA PE=1 SV=1 169 670 4.0E-40
sp|P9WN10|OTSA_MYCTO Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=otsA PE=3 SV=1 169 670 4.0E-40
sp|A5U8G5|OTSA_MYCTA Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=otsA PE=3 SV=1 169 670 4.0E-40
sp|Q2NTK9|OTSA_SODGM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Sodalis glossinidius (strain morsitans) GN=otsA PE=3 SV=1 156 662 2.0E-39
sp|A1TFL3|OTSA_MYCVP Trehalose-phosphate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=otsA PE=3 SV=1 169 664 9.0E-39
sp|B2HHY2|OTSA_MYCMM Trehalose-phosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=otsA PE=3 SV=1 169 664 2.0E-38
sp|A0PUT6|OTSA_MYCUA Trehalose-phosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=otsA PE=3 SV=1 169 637 3.0E-38
sp|A4T7Q6|OTSA_MYCGI Trehalose-phosphate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=otsA PE=3 SV=1 169 664 7.0E-38
sp|Q1B321|OTSA_MYCSS Trehalose-phosphate synthase OS=Mycobacterium sp. (strain MCS) GN=otsA PE=3 SV=1 166 664 3.0E-37
sp|A1UM30|OTSA_MYCSK Trehalose-phosphate synthase OS=Mycobacterium sp. (strain KMS) GN=otsA PE=3 SV=1 166 664 3.0E-37
sp|A3Q6H9|OTSA_MYCSJ Trehalose-phosphate synthase OS=Mycobacterium sp. (strain JLS) GN=otsA PE=3 SV=1 169 664 4.0E-37
sp|P74258|GGPS_SYNY3 Glucosylglycerol-phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggpS PE=1 SV=1 228 663 6.0E-37
sp|O65979|GGPS_SYNP2 Glucosylglycerol-phosphate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ggpS PE=2 SV=2 216 663 2.0E-34
sp|A9MMQ2|OTSA_SALAR Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=otsA PE=3 SV=2 190 633 3.0E-34
sp|E1WGG8|OTSA_SALTS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain SL1344) GN=otsA PE=3 SV=1 190 633 5.0E-34
sp|Q5PMW8|OTSA_SALPA Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=otsA PE=3 SV=1 190 633 5.0E-34
sp|A9MU86|OTSA_SALPB Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=otsA PE=3 SV=1 190 633 5.0E-34
sp|P0A1Q1|OTSA_SALTI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhi GN=otsA PE=3 SV=2 190 633 5.0E-34
sp|P0CL06|OTSA_SALTY Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=otsA PE=3 SV=1 190 633 5.0E-34
sp|Q57N70|OTSA_SALCH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella choleraesuis (strain SC-B67) GN=otsA PE=3 SV=1 190 633 9.0E-34
sp|A4WBR1|OTSA_ENT38 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Enterobacter sp. (strain 638) GN=otsA PE=3 SV=1 190 632 1.0E-32
sp|A8AFD4|OTSA_CITK8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=otsA PE=3 SV=2 190 681 2.0E-32
sp|Q1RAP1|OTSA_ECOUT Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain UTI89 / UPEC) GN=otsA PE=3 SV=2 224 705 6.0E-32
sp|A1AC53|OTSA_ECOK1 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O1:K1 / APEC GN=otsA PE=3 SV=2 224 705 6.0E-32
sp|Q8FGN6|OTSA_ECOL6 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=otsA PE=3 SV=2 224 705 8.0E-32
sp|Q0TGU0|OTSA_ECOL5 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=otsA PE=3 SV=1 224 705 8.0E-32
sp|Q3Z2S4|OTSA_SHISS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Shigella sonnei (strain Ss046) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|Q32H58|OTSA_SHIDS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|B1LQW0|OTSA_ECOSM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain K12) GN=otsA PE=1 SV=3 224 705 1.0E-30
sp|B1J0J4|OTSA_ECOLC Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|B1X658|OTSA_ECODH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain K12 / DH10B) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|A7ZN22|OTSA_ECO24 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|A6TB47|OTSA_KLEP7 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=otsA PE=3 SV=1 190 633 1.0E-30
sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O157:H7 GN=otsA PE=3 SV=3 224 705 2.0E-30
sp|A8A1A0|OTSA_ECOHS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O9:H4 (strain HS) GN=otsA PE=3 SV=1 224 705 2.0E-30
sp|P55612|OTSA_RHISN Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Rhizobium sp. (strain NGR234) GN=otsA PE=3 SV=1 224 664 3.0E-30
sp|Q6JTB2|OTSA_PSESS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pseudomonas savastanoi GN=otsA PE=3 SV=1 224 705 6.0E-30
sp|A7MEE9|OTSA_CROS8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=otsA PE=3 SV=1 190 632 2.0E-27
sp|Q5K2C4|TPS1_APHAV Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aphelenchus avenae GN=tps-1 PE=2 SV=1 221 664 2.0E-23
sp|Q5K2C1|TPS2_APHAV Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aphelenchus avenae GN=tps-2 PE=2 SV=1 221 664 6.0E-23
sp|O45380|TPS2_CAEEL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Caenorhabditis elegans GN=tps-2 PE=2 SV=3 221 604 8.0E-21
sp|Q7YZT6|TPS1_CAEEL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Caenorhabditis elegans GN=tps-1 PE=2 SV=1 221 604 5.0E-19
sp|A8WRG3|TPS1_CAEBR Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Caenorhabditis briggsae GN=tps-1 PE=3 SV=2 221 604 1.0E-17
sp|Q8SSL0|TPP_ENCCU Probable trehalose-phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0870 PE=1 SV=1 262 368 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005992 trehalose biosynthetic process Yes
GO:0046351 disaccharide biosynthetic process No
GO:0005984 disaccharide metabolic process No
GO:0009312 oligosaccharide biosynthetic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009311 oligosaccharide metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005991 trehalose metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|034660
MAGLRNHRVVIASLFLPTTAVLGESVPATPEIPPDGVDFLPKFSNSEKPSRVLPVHNHHSSVSGITQTIRSIVED
LQDKTRGPSPAARSPNSEAGNPFTKLTRFADVVLEHIAASDKLSNVVYSPPTCRKQISSSSAESRLQRKHSRSAS
RHPPRILKDQLWHFESNPRCNGGLKNAVESVGNKIQRKLWVGTLGTCTDNFGEAVRDDIDTRMFTEESSVPVWIP
DSEFQSCYDEFCHQVLWPALHSAVPDAPKTKMFYESASYKQYVAVNQRFADVIVSNYREGDIIWVNDYHLMLLPL
LLRSSPRIPPSAPIGFFMHIAFPSSEIFRCLSVRRDLLSGLMAADLVGFQTPNYARHFRQTVSRILAFEALPKGI
RIPEGEENHLVKVDELVRVNGLRKEVQKPGLPGSKTAEEVLKAGDEDATKSLERERFVDVGSFPMGIDVKRLQER
KQQPDVAEWVSVLRQRYAGMKIVVGRDKLDEVQGVRHKLQAFENFLERYPEFQGKVVLIQVALQTTEVNELAGGV
ADVVSRVNSRFSTLTYQPVIFLHVQDLTFSQYLALLTVGDAFIAASLREGMALRTHEFVECQEGKQNPGCLILSE
FTGSYSYTGFRSCIAINPWDTRGTADAIYKALTANAGDSKTWWMDLHNHVITQTAQTFVNNFLNRVIRAHSEHWM
DDIEDVPHLDLTRVFPQYKHSQRRLIIVDFEGTLWKRDLSRRGLQAYLNGDFEIPEEPLNALSSLAEDRRNDVWL
LSGLPVRGVLERVAEKVPNIGIVAENGCFIKIKSGRNSPYVGEWLNLVANHNLTWKSSCLEMLNYFTERTPGSII
EEREASVIWRYWTGDPREDSSDRQWARRQAAEAQNHIFDSLGERCGLRIIPGKSSFLVLPGNISRSTAVGSILQP
GGPATSSAAVRSDRKGSFLESYSFNTLASPVISISNAALRVDEARSLGGEVDFVLVISSDEALLRRMNEIEGIHA
ECVTVSTSKKGTDAHWKLDLDEVEPTVPLSNSGPESGVSRGGGRVGTAVVEVLKRFAAVGDTKMVTPN*
Coding >Agabi119p4|034660
ATGGCTGGCCTAAGAAACCACCGCGTTGTCATTGCCTCGCTTTTTCTCCCTACCACCGCAGTTCTGGGCGAGTCA
GTGCCCGCAACTCCCGAGATACCGCCCGACGGGGTTGATTTTCTCCCCAAGTTTTCCAACAGCGAAAAGCCGTCT
CGAGTGCTACCAGTTCATAATCACCACTCGAGTGTCTCTGGTATAACCCAAACGATTAGGAGCATTGTTGAGGAT
CTGCAGGACAAAACTCGCGGACCAAGTCCTGCAGCCCGCTCCCCTAACTCTGAAGCAGGGAACCCCTTCACAAAA
CTTACTCGCTTCGCTGACGTCGTACTTGAGCATATCGCCGCCTCAGACAAGCTATCAAATGTCGTGTATTCTCCC
CCTACCTGCCGCAAGCAAATCTCCTCCAGCAGCGCTGAATCTCGCTTGCAACGCAAACACTCTAGATCAGCGTCA
CGCCATCCTCCCCGAATCTTAAAGGATCAGCTTTGGCATTTCGAGAGCAACCCTCGCTGTAATGGCGGCCTGAAA
AATGCTGTCGAGAGTGTCGGCAATAAAATACAAAGGAAGTTGTGGGTCGGTACACTCGGAACTTGTACCGATAAT
TTTGGGGAGGCTGTGAGGGATGACATAGACACTCGGATGTTCACCGAGGAGAGCAGTGTGCCAGTTTGGATCCCC
GACTCTGAATTCCAAAGTTGCTATGACGAATTTTGTCATCAGGTACTTTGGCCAGCCCTCCATTCCGCTGTTCCC
GATGCTCCGAAGACCAAAATGTTTTATGAGTCCGCTTCCTATAAGCAATATGTTGCGGTCAATCAGCGATTTGCC
GATGTCATTGTGTCTAATTACCGGGAAGGCGACATCATCTGGGTGAATGATTACCACCTCATGCTCCTCCCTCTC
CTCCTTAGATCATCGCCGCGCATACCTCCATCTGCGCCTATTGGATTTTTTATGCATATCGCGTTCCCTTCGTCA
GAAATATTCCGTTGTCTTTCTGTTCGCCGCGATTTGCTCTCTGGTCTTATGGCTGCGGATCTTGTCGGCTTCCAA
ACACCTAATTATGCTCGCCATTTCCGCCAAACAGTTAGTCGCATTCTGGCTTTCGAGGCGTTACCAAAAGGTATT
AGAATCCCTGAAGGGGAAGAAAACCACCTTGTCAAAGTTGACGAACTCGTCCGAGTCAATGGCCTCCGCAAAGAG
GTGCAGAAGCCGGGGCTCCCTGGATCGAAAACAGCTGAGGAGGTTTTGAAGGCTGGAGATGAAGACGCTACGAAG
TCTCTCGAACGCGAGCGGTTCGTGGATGTTGGTTCTTTTCCTATGGGCATAGACGTGAAGCGCCTTCAGGAGAGG
AAACAGCAACCCGATGTGGCAGAATGGGTGTCCGTCCTGAGACAACGTTACGCTGGCATGAAGATCGTCGTGGGC
AGGGACAAGCTTGATGAAGTTCAAGGCGTTAGACACAAACTTCAGGCTTTCGAAAACTTCTTGGAGAGGTATCCT
GAGTTTCAAGGAAAGGTGGTCCTGATACAGGTCGCTCTGCAGACGACGGAGGTCAATGAATTGGCTGGTGGTGTT
GCTGATGTGGTATCGAGGGTCAACTCGCGATTTTCCACGTTGACATATCAACCCGTCATCTTCTTACATGTTCAG
GACTTGACTTTCAGTCAATATCTCGCCTTGCTTACGGTTGGCGATGCTTTCATTGCAGCTAGTCTTAGGGAAGGC
ATGGCTCTTCGGACACATGAGTTTGTCGAGTGCCAAGAAGGCAAGCAGAACCCAGGGTGCTTAATTTTGAGTGAG
TTCACTGGCTCCTACAGTTACACTGGTTTCAGGAGCTGCATTGCTATCAATCCTTGGGATACTCGAGGCACTGCA
GATGCGATATACAAAGCACTTACAGCGAATGCAGGGGATAGCAAAACTTGGTGGATGGATCTCCACAATCATGTG
ATAACCCAAACAGCCCAAACGTTCGTCAATAATTTCCTCAACCGTGTCATTCGAGCGCATTCCGAACATTGGATG
GACGACATTGAAGATGTCCCACACCTAGACCTGACCAGAGTATTCCCCCAATACAAACATTCTCAAAGACGACTT
ATCATCGTTGATTTTGAGGGCACTCTTTGGAAAAGGGACCTCAGTCGCAGAGGTCTGCAAGCCTACTTGAACGGC
GATTTTGAGATACCGGAGGAACCCCTCAATGCTTTGAGTAGTCTCGCGGAGGATAGGCGAAACGATGTTTGGTTG
CTGAGTGGCCTTCCCGTTCGCGGCGTCCTTGAACGTGTGGCTGAGAAAGTTCCCAACATTGGAATTGTCGCAGAG
AATGGGTGCTTTATCAAAATCAAATCTGGCCGAAACAGCCCTTATGTGGGAGAGTGGTTGAATCTCGTCGCGAAT
CATAACTTGACGTGGAAGAGCAGCTGTCTAGAGATGTTAAATTATTTCACGGAGCGAACGCCCGGTTCTATTATC
GAGGAAAGAGAAGCTTCCGTTATATGGCGATACTGGACTGGAGACCCACGAGAGGATTCATCTGATCGTCAGTGG
GCCCGGAGACAAGCGGCCGAAGCGCAAAACCACATCTTTGATAGCCTCGGAGAGCGTTGTGGGTTGCGTATCATA
CCAGGAAAGAGCTCCTTCCTTGTCCTTCCCGGAAACATATCTAGATCTACGGCAGTCGGCAGCATCTTACAACCG
GGAGGTCCCGCTACCTCTTCGGCTGCAGTTCGTTCGGATAGGAAGGGTTCATTCTTAGAAAGTTATTCGTTTAAC
ACACTTGCTTCCCCGGTGATCTCCATCTCCAACGCCGCATTACGGGTTGATGAGGCTCGTAGCCTCGGCGGCGAA
GTTGATTTCGTGCTTGTTATCAGTTCTGATGAAGCTTTACTGAGGAGGATGAATGAGATAGAGGGAATCCATGCA
GAGTGTGTGACCGTCAGCACGAGCAAGAAAGGAACGGATGCCCATTGGAAACTAGACCTCGATGAAGTAGAACCG
ACCGTTCCTTTGTCAAATAGCGGTCCAGAATCGGGAGTTAGTAGAGGCGGTGGTAGGGTTGGTACGGCGGTTGTC
GAGGTTCTCAAACGCTTTGCGGCTGTTGGGGATACGAAGATGGTAACACCCAACTAG
Transcript >Agabi119p4|034660
ATGGCTGGCCTAAGAAACCACCGCGTTGTCATTGCCTCGCTTTTTCTCCCTACCACCGCAGTTCTGGGCGAGTCA
GTGCCCGCAACTCCCGAGATACCGCCCGACGGGGTTGATTTTCTCCCCAAGTTTTCCAACAGCGAAAAGCCGTCT
CGAGTGCTACCAGTTCATAATCACCACTCGAGTGTCTCTGGTATAACCCAAACGATTAGGAGCATTGTTGAGGAT
CTGCAGGACAAAACTCGCGGACCAAGTCCTGCAGCCCGCTCCCCTAACTCTGAAGCAGGGAACCCCTTCACAAAA
CTTACTCGCTTCGCTGACGTCGTACTTGAGCATATCGCCGCCTCAGACAAGCTATCAAATGTCGTGTATTCTCCC
CCTACCTGCCGCAAGCAAATCTCCTCCAGCAGCGCTGAATCTCGCTTGCAACGCAAACACTCTAGATCAGCGTCA
CGCCATCCTCCCCGAATCTTAAAGGATCAGCTTTGGCATTTCGAGAGCAACCCTCGCTGTAATGGCGGCCTGAAA
AATGCTGTCGAGAGTGTCGGCAATAAAATACAAAGGAAGTTGTGGGTCGGTACACTCGGAACTTGTACCGATAAT
TTTGGGGAGGCTGTGAGGGATGACATAGACACTCGGATGTTCACCGAGGAGAGCAGTGTGCCAGTTTGGATCCCC
GACTCTGAATTCCAAAGTTGCTATGACGAATTTTGTCATCAGGTACTTTGGCCAGCCCTCCATTCCGCTGTTCCC
GATGCTCCGAAGACCAAAATGTTTTATGAGTCCGCTTCCTATAAGCAATATGTTGCGGTCAATCAGCGATTTGCC
GATGTCATTGTGTCTAATTACCGGGAAGGCGACATCATCTGGGTGAATGATTACCACCTCATGCTCCTCCCTCTC
CTCCTTAGATCATCGCCGCGCATACCTCCATCTGCGCCTATTGGATTTTTTATGCATATCGCGTTCCCTTCGTCA
GAAATATTCCGTTGTCTTTCTGTTCGCCGCGATTTGCTCTCTGGTCTTATGGCTGCGGATCTTGTCGGCTTCCAA
ACACCTAATTATGCTCGCCATTTCCGCCAAACAGTTAGTCGCATTCTGGCTTTCGAGGCGTTACCAAAAGGTATT
AGAATCCCTGAAGGGGAAGAAAACCACCTTGTCAAAGTTGACGAACTCGTCCGAGTCAATGGCCTCCGCAAAGAG
GTGCAGAAGCCGGGGCTCCCTGGATCGAAAACAGCTGAGGAGGTTTTGAAGGCTGGAGATGAAGACGCTACGAAG
TCTCTCGAACGCGAGCGGTTCGTGGATGTTGGTTCTTTTCCTATGGGCATAGACGTGAAGCGCCTTCAGGAGAGG
AAACAGCAACCCGATGTGGCAGAATGGGTGTCCGTCCTGAGACAACGTTACGCTGGCATGAAGATCGTCGTGGGC
AGGGACAAGCTTGATGAAGTTCAAGGCGTTAGACACAAACTTCAGGCTTTCGAAAACTTCTTGGAGAGGTATCCT
GAGTTTCAAGGAAAGGTGGTCCTGATACAGGTCGCTCTGCAGACGACGGAGGTCAATGAATTGGCTGGTGGTGTT
GCTGATGTGGTATCGAGGGTCAACTCGCGATTTTCCACGTTGACATATCAACCCGTCATCTTCTTACATGTTCAG
GACTTGACTTTCAGTCAATATCTCGCCTTGCTTACGGTTGGCGATGCTTTCATTGCAGCTAGTCTTAGGGAAGGC
ATGGCTCTTCGGACACATGAGTTTGTCGAGTGCCAAGAAGGCAAGCAGAACCCAGGGTGCTTAATTTTGAGTGAG
TTCACTGGCTCCTACAGTTACACTGGTTTCAGGAGCTGCATTGCTATCAATCCTTGGGATACTCGAGGCACTGCA
GATGCGATATACAAAGCACTTACAGCGAATGCAGGGGATAGCAAAACTTGGTGGATGGATCTCCACAATCATGTG
ATAACCCAAACAGCCCAAACGTTCGTCAATAATTTCCTCAACCGTGTCATTCGAGCGCATTCCGAACATTGGATG
GACGACATTGAAGATGTCCCACACCTAGACCTGACCAGAGTATTCCCCCAATACAAACATTCTCAAAGACGACTT
ATCATCGTTGATTTTGAGGGCACTCTTTGGAAAAGGGACCTCAGTCGCAGAGGTCTGCAAGCCTACTTGAACGGC
GATTTTGAGATACCGGAGGAACCCCTCAATGCTTTGAGTAGTCTCGCGGAGGATAGGCGAAACGATGTTTGGTTG
CTGAGTGGCCTTCCCGTTCGCGGCGTCCTTGAACGTGTGGCTGAGAAAGTTCCCAACATTGGAATTGTCGCAGAG
AATGGGTGCTTTATCAAAATCAAATCTGGCCGAAACAGCCCTTATGTGGGAGAGTGGTTGAATCTCGTCGCGAAT
CATAACTTGACGTGGAAGAGCAGCTGTCTAGAGATGTTAAATTATTTCACGGAGCGAACGCCCGGTTCTATTATC
GAGGAAAGAGAAGCTTCCGTTATATGGCGATACTGGACTGGAGACCCACGAGAGGATTCATCTGATCGTCAGTGG
GCCCGGAGACAAGCGGCCGAAGCGCAAAACCACATCTTTGATAGCCTCGGAGAGCGTTGTGGGTTGCGTATCATA
CCAGGAAAGAGCTCCTTCCTTGTCCTTCCCGGAAACATATCTAGATCTACGGCAGTCGGCAGCATCTTACAACCG
GGAGGTCCCGCTACCTCTTCGGCTGCAGTTCGTTCGGATAGGAAGGGTTCATTCTTAGAAAGTTATTCGTTTAAC
ACACTTGCTTCCCCGGTGATCTCCATCTCCAACGCCGCATTACGGGTTGATGAGGCTCGTAGCCTCGGCGGCGAA
GTTGATTTCGTGCTTGTTATCAGTTCTGATGAAGCTTTACTGAGGAGGATGAATGAGATAGAGGGAATCCATGCA
GAGTGTGTGACCGTCAGCACGAGCAAGAAAGGAACGGATGCCCATTGGAAACTAGACCTCGATGAAGTAGAACCG
ACCGTTCCTTTGTCAAATAGCGGTCCAGAATCGGGAGTTAGTAGAGGCGGTGGTAGGGTTGGTACGGCGGTTGTC
GAGGTTCTCAAACGCTTTGCGGCTGTTGGGGATACGAAGATGGTAACACCCAACTAG
Gene >Agabi119p4|034660
ATGGCTGGCCTAAGAAACCACCGCGTTGTCATTGCCTCGCTTTTTCTCCCTACCACCGCAGTTCTGGGCGAGTCA
GTGCCCGCAACTCCCGAGATACCGCCCGACGGGGTTGATTTTCTCCCCAAGTTTTCCAACAGCGAAAAGCCGTCT
CGAGTGCTACCAGTTCATAATCACCACTCGAGTGTCTCTGGTATAACCCAAACGATTAGGAGCATTGTTGAGGAT
CTGCAGGACAAAGTGCGTATCCCAGCCGTACAAGAAGGCCTCGTTGTACATAGTAATGGATGGATGTTAGACTCG
CGGACCAAGTCCTGCAGCCCGCTCCCCTAACTCTGAAGCAGGGAACCCCTTCACAAAACTTACTCGCTTCGCTGA
CGTCGTACTTGAGCATATCGCCGCCTCAGACAAGCTATCAAATGTCGTGTATTCTCCCCCTACCTGCCGCAAGCA
AATCTCCTCCAGCAGCGCTGAATCTCGCTTGCAACGCAAACACTCTAGATCAGCGTCACGCCATCCTCCCCGAAT
CTTAAAGGATCAGCTTTGGCATTTCGAGAGCAACCCTCGCTGTAATGGCGGCCTGAAAAATGCTGTCGAGAGTGT
CGGCAATAAAATACAAAGGAAGTTGTGGGTCGGTACACTCGGAACTTGTACCGATAATTTTGGGGAGGCTGTGAG
GGATGACATAGACACTCGGATGTTCACCGAGGAGAGCAGTGTGCCAGTTTGGATCCCCGACTCTGAATTCCAAAG
TTGCTATGACGAATTTTGTCATCAGGTTGAGTATATGTTCTGCCACACATTGAATATAGCTAATCTAGACCTAGG
TACTTTGGCCAGCCCTCCATTCCGCTGTTCCCGATGCTCCGAAGACCAAAATGTTTTATGAGTCCGCTTCCTATA
AGCAATATGTTGCGGTCAATCAGCGATTTGCCGATGTCATTGTGTCTAATTACCGGGAAGGCGACATCAGTGAGT
CTGACCCTCATTTCTACATCAACGAGCTCAATGGTTTGAATAGTCTGGGTGAATGATTACCACCTCATGCTCCTC
CCTCTCCTCCTTAGATCATCGCCGCGCATACCTCCATCTGCGCCTATTGGATTTTTTATGCATATCGCGTTCCCT
TCGTCAGAAATATTCCGTTGTCTTTCTGTTCGCCGCGATTTGCTCTCTGGTCTTATGGCTGCGGATCTTGTCGGC
TTCCAAACACCTAATTATGCTCGCCATTTCCGCCAAACAGTTAGTCGCATTCTGGCTTTCGAGGCGTTACCAAAA
GGTATTAGAATCCCTGAAGGGGAAGAAAACCACCTTGTCAAAGTTGACGAACTCGTCCGAGTCAATGGCCTCCGC
AAAGAGGTGCAGAAGCCGGGGCTCCCTGGATCGAAAACAGCTGAGGAGGTTTTGAAGGCTGGAGATGAAGACGCT
ACGAAGTCTCTCGAACGCGAGCGGTTCGTGGATGTTGGTTCTTTTCCTATGGGCATAGACGTGAAGCGCCTTCAG
GAGAGGAAGTAAGGTTTCTGCTATAGCATTCATAGACACAATCTGACGTACTCACAGACAGCAACCCGATGTGGC
AGAATGGGTGTCCGTCCTGAGACAACGTTACGCTGGCATGAAGATCGTCGTGGGCAGGGACAAGCTTGATGAAGT
TCAAGGCGTTAGACACAAACTTCAGGCTTTCGAAAACTTCTTGGAGAGGTATCCTGAGTTTCAAGGAAAGGTACA
TCATAATCAAGCAACATATCATCTGATATGCCGTACTGATTATTTATGTTTTAGGTGGTCCTGATACAGGTCGCT
CTGCAGACGACGGAGGTCAATGAATTGGCTGGTGGTGTTGCTGATGTGGTATCGAGGGTCAACTCGCGATTTTCC
ACGTTGACATATCAACCCGTCATCTTCTTACATGTATGCTTTTCAGTTTTCACAACACCGCGGCCCTAAATAACC
CCATTGACAGGTTCAGGACTTGACTTTCAGTCAATATCTCGCCTTGCTTACGGTTGGCGATGCTTTCATTGCAGC
TAGTCTTAGGGAAGGCATGGCTCTTCGGACACATGAGTTTGTCGAGTGCCAAGAAGGCAAGCAGAACCCAGGGTG
CTTAATTTTGAGTGAGGTGGGTATACTTATGTCTGCTTCCAAGAACGTAGCTAAACATTTTATCAGTTCACTGGC
TCCTACAGTTACACTGGTTTCAGGAGCTGCATTGCTATCAATCCTTGGGATACTCGAGGCACTGCAGATGCGATA
TACAAAGCACTTACAGCGAATGCAGGGGATAGCAAAACTTGGTGGATGGTAAATCAAATGTCATCACTTACCCGT
CAAACTGACAATTCTCATTTAAGGATCTCCACAATCATGTGATAACCCAAACAGCCCAAACGTTCGTCAATAATT
TCCTCAACCGTGTCATTCGAGCGCATTCCGAACATTGGATGGACGACATTGAAGATGTCCCACACCTAGACCTGA
CCAGAGTATTCCCCCAGTGTGTACAATCTATGCTCTATATTCATTGGTGCTCATGTTCTGCTGCAGATACAAACA
TTCTCAAAGACGACTTATCATCGTTGATTTTGAGGGCACTCTTTGGAAAAGGGACCTCAGTCGCAGAGGTCTGCA
AGCCTACTTGAACGGCGATTTTGAGATACCGGAGGAACCCCTCAATGCTTTGAGTAGTCTCGCGGAGGATAGGCG
AAACGATGTTTGGTTGCTGAGTGGCCTTCCCGTTCGCGGCGTCCTTGAACGTGTGGCTGAGAAAGTTCCCAACAT
TGGAATTGTGTAAGATCATGCTGAGTATCTATTGATCATCTCTCAAGATATTATTAGCGCAGAGAATGGGTGCTT
TATCAAAATCAAATCTGGCCGAAACAGCCCTTATGTGGGAGAGTGGTTGAATCTCGTCGCGAATCATAACTTGAC
GTGGAAGAGCAGCTGTCTAGAGATGTTAAATTATGTGAGTCAATCTACTCTTAGTCCTCAACGACCTATTCATCT
ATTGCATCAGTTCACGGAGCGAACGCCCGGTTCTATTATCGAGGAAAGAGAAGCTTCCGTTATATGGCGATACTG
GACTGGAGACCCACGAGAGGATTCATCTGATCGTCAGTGGGCCCGGAGACAAGCGGCCGAAGCGCAAAACCACAT
CTTTGATAGCCTCGGAGAGCGTTGTGGGTTGCGTATCATACCAGGAAAGAGCTCCTTCCTTGTCCTTCCCGGAAA
CATATCTAGATCTACGGCAGTCGGCAGCATCTTACAACCGGGAGGTCCCGCTACCTCTTCGGCTGCAGTTCGTTC
GGATAGGAAGGGTTCATTCTTAGAAAGTTATTCGTTTAACACACTTGCTTCCCCGGTGATCTCCATCTCCAACGC
CGCATTACGGGTTGATGAGGCTCGTAGCCTCGGCGGCGAAGTTGATTTCGTGCTTGTTATCAGTTCTGATGAAGC
TTTACTGAGGAGGATGAATGAGATAGAGGGAATCCATGCAGAGTGTGTGACCGTCAGCACGAGCAAGAAAGGAAC
GGATGCCCATTGGAAACTAGACCTCGATGAAGTAGAACCGACCGTTCCTTTGTCAAATAGCGGTCCAGAATCGGG
AGTTAGTAGAGGCGGTGGTAGGGTTGGTACGGCGGTTGTCGAGGTTCTCAAACGCTTTGCGGCTGTTGGGGATAC
GAAGATGGTAACACCCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail