Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|034370
Gene name
Locationscaffold_13:242887..243414
Strand+
Gene length (bp)527
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 3.9E-09 24 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 25 115 2.0E-12
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 6 115 4.0E-10
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 25 114 6.0E-09
sp|Q9ZP41|EGC_CITJA EG45-like domain containing protein OS=Citrus jambhiri GN=CjBAp12 PE=1 SV=1 19 113 9.0E-07
sp|Q9ZV52|EGC2_ARATH EG45-like domain containing protein 2 OS=Arabidopsis thaliana GN=EGC2 PE=2 SV=2 7 110 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 25 115 2.0E-12
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 6 115 4.0E-10
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 25 114 6.0E-09
sp|Q9ZP41|EGC_CITJA EG45-like domain containing protein OS=Citrus jambhiri GN=CjBAp12 PE=1 SV=1 19 113 9.0E-07
sp|Q9ZV52|EGC2_ARATH EG45-like domain containing protein 2 OS=Arabidopsis thaliana GN=EGC2 PE=2 SV=2 7 110 2.0E-06
sp|Q7XVA8|RIP1_ORYSJ Putative ripening-related protein 1 OS=Oryza sativa subsp. japonica GN=Os04g0364800 PE=3 SV=2 39 112 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|034370
MKFSNSLSALLVSANLMLAAKAYKGDATFYDPGLGACGHTNQAHELVVALPSAKYGSGDHCSKHVGIHYKGKYVK
AKVVDKCPGCGSNDLDISPTAFSHLASQDLGRIKVDWEFL*
Coding >Agabi119p4|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGCCACCTTTTATGATCCTGGTCTGGGAGCTTGTGGTCATACGAATCAGGCTCATGAACTTGTTGTTGCCCTT
CCATCAGCCAAATACGGCAGCGGAGACCATTGTTCCAAGCATGTCGGTATCCACTACAAAGGCAAATACGTGAAA
GCCAAAGTAGTCGATAAATGTCCCGGTTGTGGTTCGAACGATTTAGACATCTCACCAACCGCATTCTCTCATTTA
GCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCTGA
Transcript >Agabi119p4|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGCCACCTTTTATGATCCTGGTCTGGGAGCTTGTGGTCATACGAATCAGGCTCATGAACTTGTTGTTGCCCTT
CCATCAGCCAAATACGGCAGCGGAGACCATTGTTCCAAGCATGTCGGTATCCACTACAAAGGCAAATACGTGAAA
GCCAAAGTAGTCGATAAATGTCCCGGTTGTGGTTCGAACGATTTAGACATCTCACCAACCGCATTCTCTCATTTA
GCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCTGA
Gene >Agabi119p4|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGGTCAGTTATGACAGTGTCGCCCATCCTATCGTCAATGATGCTGATTTTGTTCTCGCACCTTTTTAGCCACC
TTTTATGATCCTGGTGTACGTTTTTCTTACACTTTCCACCAAGATTCCTCACCCGCTCATTTCACAATTAGCTGG
GAGCTTGTGGTCATACGAATCAGGCTCATGAACTTGTTGTTGCCCTTCCATCAGCCAAATACGGCAGCGGAGACC
ATTGTTCCAAGCATGTCGGTATCCACTGTAAGCTTCCTCCTTCTACTCCCTCCTCAAAAACCAAAATTCATTCAT
TGCAATAAGACAAAGGCAAATACGTGAAAGCCAAAGTAGTCGATAAATGTCCCGGTTGTGGTTCGAACGATTTAG
ACATCTCACCAACCGCATTCTCTCATTTAGCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail