Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|033400
Gene name
Locationscaffold_12:1517871..1525096
Strand+
Gene length (bp)7225
Transcript length (bp)6480
Coding sequence length (bp)6480
Protein length (aa) 2160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 1.5E-135 1705 2101
PF00169 PH PH domain 9.3E-11 1273 1368
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.8E-09 1055 1126
PF13637 Ank_4 Ankyrin repeats (many copies) 4.0E-06 1065 1118
PF00023 Ank Ankyrin repeat 7.1E-04 1098 1124
PF15409 PH_8 Pleckstrin homology domain 1.3E-07 1280 1366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1682 2097 1.0E-104
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1684 2098 3.0E-102
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1443 2084 3.0E-95
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 1274 2094 1.0E-75
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 1272 2094 6.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1682 2097 1.0E-104
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1684 2098 3.0E-102
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1443 2084 3.0E-95
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 1274 2094 1.0E-75
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 1272 2094 6.0E-75
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 1705 2092 3.0E-68
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 1705 2094 4.0E-68
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 1611 2100 9.0E-67
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 1691 2092 2.0E-66
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 1705 2107 1.0E-65
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 1705 2092 2.0E-65
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 1705 2084 9.0E-65
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 1675 2091 1.0E-64
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 1680 2092 2.0E-64
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 1704 2107 6.0E-64
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 1611 2094 2.0E-62
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 1705 2107 2.0E-62
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 1686 2098 6.0E-61
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 1705 2115 2.0E-60
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 1701 2098 3.0E-60
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 1705 2107 3.0E-60
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 1686 2098 1.0E-59
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 1701 2098 2.0E-59
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 1701 2098 2.0E-58
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 1710 2071 5.0E-50
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 1705 2095 2.0E-46
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 1683 2086 5.0E-46
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 1698 2085 5.0E-43
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 1702 2132 1.0E-42
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 1707 2085 2.0E-42
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1024 1573 9.0E-41
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1066 1372 2.0E-36
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 1703 2085 1.0E-30
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1066 1372 2.0E-30
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 1715 1961 3.0E-21
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 1715 1961 2.0E-17
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 1706 1966 3.0E-17
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 1706 1960 4.0E-17
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 1682 1968 6.0E-17
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 1706 1960 1.0E-15
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 1697 1966 7.0E-15
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 1717 1966 9.0E-15
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 1699 1958 3.0E-14
sp|Q9HB20|PKHA3_HUMAN Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens GN=PLEKHA3 PE=1 SV=2 1273 1397 2.0E-12
sp|Q9ERS4|PKHA3_MOUSE Pleckstrin homology domain-containing family A member 3 OS=Mus musculus GN=Plekha3 PE=2 SV=1 1273 1397 5.0E-12
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 1030 1337 5.0E-12
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 1030 1325 2.0E-11
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 1707 1814 4.0E-11
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 1274 1390 3.0E-10
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 1030 1538 3.0E-10
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 1715 1966 4.0E-10
sp|Q5M7Y0|C43BP_DANRE Collagen type IV alpha-3-binding protein OS=Danio rerio GN=col4a3bp PE=1 SV=2 1273 1361 1.0E-09
sp|Q80W71|PKHA8_MOUSE Pleckstrin homology domain-containing family A member 8 OS=Mus musculus GN=Plekha8 PE=1 SV=2 1273 1389 2.0E-09
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 621 837 3.0E-09
sp|Q96JA3|PKHA8_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens GN=PLEKHA8 PE=1 SV=3 1273 1389 3.0E-09
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 638 834 3.0E-09
sp|D3ZY60|PKHA8_RAT Pleckstrin homology domain-containing family A member 8 OS=Rattus norvegicus GN=Plekha8 PE=1 SV=1 1273 1389 3.0E-09
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 1272 1364 3.0E-09
sp|Q6P3Q6|C43BP_XENTR Collagen type IV alpha-3-binding protein OS=Xenopus tropicalis GN=col4a3bp PE=2 SV=1 1266 1366 3.0E-09
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 641 943 4.0E-09
sp|D2KC46|PKHA8_CANLF Pleckstrin homology domain-containing family A member 8 OS=Canis lupus familiaris GN=PLEKHA8 PE=1 SV=2 1273 1389 4.0E-09
sp|F1MS15|PKHA8_BOVIN Pleckstrin homology domain-containing family A member 8 OS=Bos taurus GN=PLEKHA8 PE=3 SV=2 1273 1389 4.0E-09
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 621 945 7.0E-09
sp|Q6VVX2|C43BP_CRIGR Collagen type IV alpha-3-binding protein OS=Cricetulus griseus GN=COL4A3BP PE=1 SV=1 1266 1366 9.0E-09
sp|Q9Y5P4|C43BP_HUMAN Collagen type IV alpha-3-binding protein OS=Homo sapiens GN=COL4A3BP PE=1 SV=1 1266 1366 1.0E-08
sp|Q9GKI7|C43BP_BOVIN Collagen type IV alpha-3-binding protein OS=Bos taurus GN=COL4A3BP PE=2 SV=1 1266 1366 1.0E-08
sp|Q6NRZ4|C43BP_XENLA Collagen type IV alpha-3-binding protein OS=Xenopus laevis GN=col4a3bp PE=2 SV=1 1268 1366 1.0E-08
sp|Q5R6M6|C43BP_PONAB Collagen type IV alpha-3-binding protein OS=Pongo abelii GN=COL4A3BP PE=2 SV=1 1266 1366 1.0E-08
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 1270 1364 2.0E-08
sp|Q9EQG9|C43BP_MOUSE Collagen type IV alpha-3-binding protein OS=Mus musculus GN=Col4a3bp PE=1 SV=1 1266 1366 2.0E-08
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 1708 1973 2.0E-08
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 1714 2110 3.0E-08
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 1714 2110 5.0E-08
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 1714 2110 7.0E-08
sp|Q5U3N0|PKHA8_DANRE Pleckstrin homology domain-containing family A member 8 OS=Danio rerio GN=plekha8 PE=2 SV=1 1273 1389 1.0E-07
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 1695 1845 6.0E-07
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 1273 1500 2.0E-06
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 1273 1368 7.0E-06
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 1720 1814 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008289 lipid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|033400
MLNPRFSSLLFLSLYSTSILASNDWSKPCFNGICSYDLPYTPSGPSGTLKIWGSNTAIADITTAGGWEIIGCDPD
KEEQDIKIVCKGIDVDGDGDNDGCAHLFATTTTGDGNSSSPSSMITSLPVPTGTVVQIGDDEDQRANGKIVRLPP
ECGKQAFGRIANTWTHTDQTLPPSISKRLNLPLHRRTKHHHKIKGLTIDTQFQKTDRSKFGDVKFAIVGANVPGA
KASEDLNVNELGERKRYFVYSRVFRQRRGFGDFIDDVGGAISDGAVAVGGAISDGVGAVGEVISDGAGAVGGAIS
DGVDAVGEVISDGAGAVGDAISDGAGAVGDVIDNVGGAISDGAEAVGGAIANGAEAVSDALSEPQEISKTFSAPF
DISNTFTVFEQNIKCSAPITNTNTSINPKIGVNGKLKVDVEADVHGNVDISIFASGSLTELKLDKFELSTSLNAD
LNGAIILSAGVGGSIESGNIKLFEVGPTFQINANAKASLNIDTDMRIGVAYHIDNAKFDFPNGGKKSGSFSAGDT
PLQISAQPSSSATGTVEAHLIPSLNVGIDAFGGVAKAGVFVNLDASASVSLTVDATGPVVEGKVNRREMMVRGGG
AIGAYYFNDKRTPVPEPFGFGDIVDGIKDGAKKAAGAVKSGAKKAAGAVESGAKKVVDGAKKAVENGEKKVAGAV
KEGAKKIEKGAKKVGGAVKEGAEKVEEGAKKVAKKVEDGAKKAGKAVKEGAEKVEEGAKKVVKEGAKKVEEGAKK
AGKAVKEGAEKVEEGAKKVVKEGAKKVEEGAKKAGKVVKEGAEKVEEGAKKAGKAVKDGAEKVEDGAKKIVKEGA
EKVEEGAKKAGKAVKAGAEKVEEGAKKIVKEKAEKVEEAGKVIKEGAEKVGEVVKEGAEKVEEGVKKAGKVIDEG
AKKIVNGKVEKEGAEKVEKGAKEDAKKEDAKTGGATDDVSFGGCVEVGAGLSVNVGADANFFGLFDPLKKIPLFE
KQFSLLKTCFGEQKRRDLSVVGRGLTCNGVNVRGVVELCGVWFLWAAMEAVYQVKLLAALRSGDPARIHPFLAEI
GKDRSVSSLDCSAAALHLAVRCASTETVALLLAHRAISPNGVHPPASGTTPLHLAASLGRVDIVTLLLDQDGIDD
TLLDDQRKSCRDLAKTRDTLKAIDDSRTLLNASYRSLLRSYILSPFTDPPSPALLHLLSGPRTSLINLSYLDDDS
GSSLLHEAANRKDLRLIELAVRAGADVFVRNRRGKMAYEIVKDDKVKVFLRQFANHDHSFIRSSFSASDPPALKG
YLNKYTNVARGYHTRWFVLAHGVLSYYRHQQDESVSSRGSISMKSAIVKINEQHRNRFEIQSRLASASVQKWYIK
ANHPVEAARWILALNKSIEWARAAPEPPRSSAERSIAESDSIHAALSTDPNLSDINPDEDEEEGTRMPTDDASSM
GMVSRHDDIYELQGNSILAQLEMTQRLLVSYFGGSTSSARSISSTHSTSQEIKSTILESMSTLSTLAQEYTSMSK
DREQCFQKALAQEKARQKVWEESLATVVREGATLEEELRNRSRKRGSKIFGPGEGFVAALSGIGEEKESALGVTL
VASPPAIDSPWQESPLAEPVRPRTSTNETVKPRQDGDSDEEDEEDEFFDAIDSNNLPHLVVPPSLAVISPTTSPH
PASPTKVKLPPTAQIQPPPLSPAFIPSFIDMGPYKGYEVLRTKLGLMDDERPPTSLWSVLKHSIGKDLTRISFPV
FFNEPTSMLQRMAEDMEFSECLDTAATEMESLKRLAYVAAFAMSNYSSTIGRIAKPFNPMLSETFEYVRLDKKYR
YVSEQVSHHPPISACWAESPLWHYFGEVDAQNKFMGKSFEIRPTGVAHAELILPESWVEEDKKGYRKAQGVCGGE
GKVVEHYTWKKVTTNVSGFILGSPTIDHYGDMTVVNHATNEKCVLTFKPRGWRGKDAYEIAGQVLDAKGRAVYEI
AGRWNSQLIMRPVGSGGVLHPDTTVSSSSLDDLELNTNNNNSPEYTLLWKNSPKPIGSPFNLTPFAITLNECSKE
TLLPFLCPTDCRLRPDQRAFEMGKYDLANELKMRQEERQRGTRKEREMGVRGEHRPRWFEARTDGDTGERVWMPK
KVMVEFRVGSEEGEGEEVRRREEEVEYWAERERVWREGGFKRWKDVEEIFVEEPEVLRD*
Coding >Agabi119p4|033400
ATGTTAAATCCCCGATTCTCCTCTCTCCTCTTCCTCTCCCTCTATTCAACATCCATCCTCGCATCAAACGACTGG
TCCAAACCCTGTTTCAACGGTATCTGTTCCTACGATCTACCCTACACCCCCTCCGGTCCATCCGGCACACTCAAA
ATCTGGGGATCCAATACCGCCATAGCGGATATAACAACTGCAGGAGGATGGGAAATCATAGGCTGCGATCCGGAT
AAAGAAGAACAAGATATCAAAATCGTGTGTAAAGGTATAGATGTCGACGGTGACGGCGATAATGACGGTTGTGCG
CATTTATTCGCTACTACTACTACTGGCGATGGAAACTCGTCGTCACCTTCGAGTATGATTACCAGTCTTCCTGTA
CCTACAGGAACAGTTGTTCAAATCGGAGACGACGAAGATCAACGAGCTAATGGTAAAATCGTTCGATTACCTCCC
GAGTGTGGTAAACAAGCTTTCGGACGTATAGCCAACACCTGGACACACACAGACCAAACTCTCCCTCCCTCCATC
TCCAAACGCCTAAACCTCCCCCTTCACCGCCGTACCAAACACCATCACAAAATCAAAGGCCTCACCATTGACACC
CAATTCCAAAAAACCGACCGCTCTAAATTCGGTGACGTCAAATTCGCAATTGTAGGCGCTAATGTGCCAGGAGCG
AAAGCGTCGGAAGATTTGAATGTTAATGAACTTGGGGAGAGGAAGAGATATTTTGTTTATTCGAGGGTGTTTAGA
CAAAGGAGGGGATTTGGTGATTTTATTGATGATGTGGGGGGTGCTATAAGTGACGGCGCAGTAGCAGTGGGCGGT
GCTATTAGTGATGGCGTGGGAGCAGTTGGCGAAGTTATCAGCGATGGTGCCGGCGCAGTTGGTGGCGCTATTAGC
GACGGTGTTGACGCGGTTGGCGAAGTTATCAGCGATGGTGCCGGCGCAGTGGGTGATGCTATAAGTGATGGCGCT
GGTGCAGTTGGTGATGTTATTGATAACGTGGGCGGGGCTATCAGCGACGGCGCAGAAGCAGTCGGCGGTGCCATA
GCCAATGGCGCAGAAGCAGTCAGCGACGCCCTTTCCGAACCCCAAGAAATCAGCAAAACCTTTTCCGCCCCCTTC
GACATCAGCAACACCTTCACCGTCTTTGAACAAAACATCAAATGTTCAGCTCCAATCACCAACACAAACACCTCA
ATAAATCCCAAAATCGGAGTAAATGGAAAACTCAAGGTCGATGTAGAGGCGGATGTACATGGAAATGTGGATATT
AGTATTTTTGCGAGTGGATCGTTGACGGAATTGAAATTGGATAAATTCGAGTTGAGCACTAGTTTGAATGCGGAT
TTGAATGGGGCGATTATCTTGTCAGCTGGGGTGGGTGGGTCCATCGAATCCGGAAATATCAAGCTTTTCGAAGTC
GGACCTACGTTCCAAATCAACGCTAATGCCAAGGCGTCGCTGAACATTGACACCGATATGCGGATTGGCGTTGCA
TATCATATTGATAACGCCAAGTTTGATTTCCCGAATGGGGGAAAGAAAAGTGGATCGTTTAGTGCTGGGGATACA
CCACTTCAAATATCGGCGCAACCGTCATCTTCAGCAACAGGCACAGTCGAAGCGCATCTGATTCCAAGTCTGAAC
GTGGGTATAGATGCGTTTGGAGGAGTGGCCAAGGCGGGAGTGTTTGTGAATTTGGATGCGTCGGCAAGTGTGAGT
TTGACGGTGGATGCGACGGGGCCGGTTGTAGAGGGGAAAGTGAATCGGCGGGAAATGATGGTGCGGGGAGGGGGA
GCTATTGGAGCGTATTATTTTAATGATAAGCGGACGCCTGTACCTGAGCCGTTTGGATTTGGGGATATTGTGGAT
GGGATCAAGGATGGAGCGAAGAAAGCTGCGGGGGCGGTGAAGAGTGGGGCCAAGAAGGCTGCTGGTGCGGTCGAG
AGCGGTGCAAAAAAGGTTGTTGACGGAGCGAAAAAAGCAGTTGAAAATGGAGAGAAGAAAGTAGCTGGGGCGGTG
AAAGAAGGAGCGAAAAAGATTGAAAAAGGTGCAAAGAAAGTTGGCGGAGCGGTCAAGGAGGGAGCAGAAAAAGTG
GAAGAGGGCGCCAAAAAGGTCGCCAAAAAGGTTGAAGACGGTGCCAAGAAGGCGGGCAAAGCTGTGAAAGAAGGT
GCCGAAAAGGTCGAAGAGGGTGCTAAGAAGGTAGTTAAAGAGGGCGCCAAAAAGGTCGAGGAAGGAGCCAAGAAA
GCAGGCAAAGCTGTGAAAGAGGGCGCGGAGAAGGTCGAGGAAGGTGCCAAAAAGGTAGTTAAAGAGGGTGCCAAA
AAAGTGGAAGAGGGAGCCAAGAAGGCAGGTAAAGTTGTTAAGGAGGGAGCCGAAAAAGTGGAAGAAGGTGCGAAG
AAGGCGGGTAAAGCTGTGAAAGACGGCGCCGAAAAGGTCGAAGACGGCGCTAAAAAGATAGTCAAAGAGGGCGCC
GAAAAGGTCGAGGAAGGTGCGAAGAAGGCGGGTAAGGCTGTGAAAGCGGGCGCCGAAAAGGTTGAGGAAGGTGCC
AAGAAGATAGTCAAGGAGAAAGCAGAAAAAGTGGAAGAGGCAGGTAAAGTGATTAAAGAAGGAGCAGAAAAGGTC
GGGGAGGTAGTCAAAGAGGGCGCCGAAAAGGTTGAGGAAGGCGTCAAGAAGGCAGGAAAAGTGATTGATGAAGGC
GCCAAGAAGATAGTCAACGGGAAAGTCGAGAAAGAAGGAGCAGAAAAAGTGGAGAAAGGTGCCAAGGAGGATGCC
AAGAAAGAGGACGCCAAGACAGGGGGAGCAACGGATGACGTCAGCTTTGGGGGATGCGTCGAGGTGGGCGCGGGG
TTGTCGGTGAACGTCGGAGCCGATGCCAACTTTTTCGGGCTGTTCGATCCGTTGAAGAAGATTCCGCTGTTTGAG
AAGCAGTTTTCGTTGCTCAAGACATGTTTTGGAGAACAGAAGCGACGGGACCTGAGTGTGGTAGGCCGGGGACTG
ACGTGTAATGGAGTGAATGTTCGCGGGGTAGTCGAGTTGTGCGGTGTTTGGTTCCTCTGGGCAGCCATGGAGGCG
GTCTACCAAGTCAAACTTCTCGCCGCCCTCAGATCAGGCGATCCAGCGCGGATCCACCCCTTTCTGGCTGAAATT
GGCAAGGACCGGTCGGTGTCGTCTCTCGACTGTTCAGCTGCAGCTCTCCACCTCGCCGTCCGATGTGCCTCCACC
GAGACGGTCGCCCTCCTTCTCGCCCACCGTGCCATCTCGCCCAACGGTGTTCACCCCCCCGCCTCGGGCACCACG
CCCCTCCACCTCGCCGCCTCCCTTGGCAGAGTCGACATCGTCACCCTCCTCCTCGACCAGGACGGCATCGACGAT
ACCCTCCTCGACGACCAGCGCAAGTCCTGCCGCGACCTCGCCAAAACCAGAGACACCCTCAAAGCCATCGATGAC
TCACGCACCCTTCTCAATGCCTCTTACCGCTCCCTCCTCCGCTCCTACATCCTCTCCCCCTTCACCGACCCTCCC
TCTCCTGCACTCCTCCACCTCCTCAGCGGACCCCGGACCTCCCTCATCAACCTCTCCTATCTCGACGACGATTCT
GGTTCCTCTCTCTTGCACGAAGCCGCCAACAGAAAGGATCTCCGTCTCATCGAGCTCGCCGTCCGCGCCGGCGCA
GATGTCTTTGTCCGCAACCGCAGGGGAAAGATGGCCTATGAGATCGTCAAGGATGACAAGGTCAAGGTATTCCTA
CGTCAATTCGCCAATCACGATCACTCCTTCATTCGATCCTCCTTCTCCGCTTCAGATCCACCCGCACTCAAGGGC
TATCTCAACAAATACACCAACGTCGCCAGGGGCTACCACACCCGCTGGTTTGTCCTCGCCCATGGTGTCCTCTCA
TACTACCGTCACCAGCAAGACGAGTCTGTATCGTCTCGCGGCTCCATTTCCATGAAATCTGCCATCGTCAAAATC
AACGAACAACACCGCAATAGATTCGAAATCCAGTCCCGACTCGCTTCTGCCTCGGTCCAAAAATGGTACATTAAA
GCAAATCACCCTGTCGAAGCCGCACGTTGGATTCTCGCTCTCAACAAAAGCATAGAATGGGCTAGAGCCGCACCG
GAACCTCCTAGATCCAGTGCTGAAAGGAGTATTGCCGAGTCCGATTCCATCCATGCTGCCCTCAGCACCGACCCT
AATTTGTCGGATATCAATCCGGATGAGGATGAGGAAGAGGGGACAAGGATGCCGACGGATGATGCGTCTTCAATG
GGGATGGTGTCTCGTCATGACGACATTTATGAACTTCAAGGAAACTCGATTTTGGCTCAGCTGGAGATGACACAG
AGGTTGCTCGTGTCTTATTTTGGAGGTTCGACGTCCTCTGCGCGGTCGATCAGTTCGACCCATTCGACGAGTCAA
GAAATCAAGTCTACTATCCTTGAATCCATGTCTACCCTGTCTACTCTTGCGCAAGAATATACGTCCATGTCGAAA
GACCGTGAACAGTGTTTTCAGAAAGCGCTCGCTCAGGAAAAAGCGAGACAGAAGGTGTGGGAAGAGTCCTTGGCG
ACGGTCGTCAGAGAGGGGGCGACGTTGGAAGAAGAGTTGAGGAATAGGAGTAGGAAGAGGGGGTCTAAAATTTTT
GGACCTGGGGAAGGGTTTGTTGCCGCTTTGAGCGGCATTGGGGAGGAGAAGGAAAGTGCTTTGGGAGTGACGTTG
GTCGCTTCCCCTCCTGCCATTGACAGTCCGTGGCAAGAGTCGCCGTTGGCGGAACCCGTTCGACCACGAACGTCG
ACGAATGAAACGGTGAAACCGCGTCAGGATGGGGATTCGGATGAAGAAGACGAGGAAGATGAATTTTTTGATGCA
ATTGATTCGAACAATCTACCTCATCTCGTTGTCCCTCCTTCCCTTGCCGTCATCTCCCCCACCACTTCGCCTCAT
CCAGCCTCCCCCACCAAAGTCAAACTACCGCCGACAGCACAGATTCAACCACCACCCCTATCCCCCGCATTTATA
CCGTCGTTTATTGATATGGGACCCTACAAGGGGTATGAGGTGTTGAGGACCAAATTGGGATTGATGGACGATGAG
AGGCCGCCGACGAGTTTGTGGAGTGTGTTGAAACATTCGATTGGGAAGGATTTGACGAGGATTAGTTTTCCCGTC
TTTTTTAATGAGCCGACGAGTATGTTGCAGAGGATGGCGGAGGATATGGAGTTTAGTGAGTGTTTGGATACGGCC
GCGACGGAGATGGAGTCGTTGAAGCGGTTGGCTTATGTCGCTGCTTTTGCGATGAGTAATTATTCGAGTACGATT
GGGAGGATTGCGAAACCGTTTAATCCGATGTTGAGCGAGACGTTTGAGTATGTGAGGTTGGACAAGAAATATCGG
TATGTGTCGGAACAAGTCAGTCATCATCCACCGATTTCGGCGTGTTGGGCAGAATCGCCTTTGTGGCATTATTTT
GGAGAGGTGGATGCGCAAAACAAGTTTATGGGTAAATCGTTTGAGATTAGACCTACGGGTGTGGCGCATGCTGAA
TTGATTTTACCGGAATCGTGGGTGGAGGAGGATAAGAAAGGGTATAGAAAGGCGCAAGGGGTGTGTGGGGGAGAG
GGAAAGGTGGTGGAACATTATACGTGGAAAAAGGTGACGACGAATGTGTCGGGGTTTATTTTGGGGAGTCCGACG
ATTGATCATTATGGAGATATGACTGTGGTGAATCATGCTACGAATGAGAAATGTGTATTGACGTTTAAACCACGT
GGATGGAGGGGTAAAGATGCGTATGAGATTGCGGGACAGGTGTTGGATGCGAAAGGGAGGGCTGTGTATGAGATT
GCGGGGAGGTGGAATTCACAGTTGATTATGAGGCCTGTGGGGAGTGGGGGAGTGTTGCATCCTGATACGACAGTG
TCGTCTTCGTCTTTGGATGATTTGGAACTCAACACCAACAACAACAACAGTCCGGAATATACTCTGCTATGGAAA
AACTCACCGAAACCGATTGGGTCTCCGTTCAACTTGACACCGTTTGCGATTACGTTGAATGAATGTTCGAAAGAG
ACGCTTTTACCGTTTTTGTGTCCGACGGATTGTAGATTGAGACCGGATCAGAGGGCGTTTGAGATGGGGAAATAT
GATTTGGCGAATGAGTTGAAGATGAGGCAGGAAGAGAGGCAGAGGGGGACGAGGAAGGAGAGGGAGATGGGGGTG
AGGGGGGAACATAGGCCGAGGTGGTTTGAGGCGAGGACGGATGGGGATACGGGGGAGAGGGTGTGGATGCCGAAA
AAGGTGATGGTGGAGTTTAGGGTGGGGAGTGAGGAGGGGGAGGGGGAGGAGGTGAGGAGGAGGGAGGAGGAGGTT
GAGTATTGGGCGGAGAGGGAGAGGGTTTGGAGGGAGGGTGGGTTTAAGAGGTGGAAGGATGTGGAGGAGATATTT
GTGGAGGAGCCGGAGGTTTTGAGGGACTGA
Transcript >Agabi119p4|033400
ATGTTAAATCCCCGATTCTCCTCTCTCCTCTTCCTCTCCCTCTATTCAACATCCATCCTCGCATCAAACGACTGG
TCCAAACCCTGTTTCAACGGTATCTGTTCCTACGATCTACCCTACACCCCCTCCGGTCCATCCGGCACACTCAAA
ATCTGGGGATCCAATACCGCCATAGCGGATATAACAACTGCAGGAGGATGGGAAATCATAGGCTGCGATCCGGAT
AAAGAAGAACAAGATATCAAAATCGTGTGTAAAGGTATAGATGTCGACGGTGACGGCGATAATGACGGTTGTGCG
CATTTATTCGCTACTACTACTACTGGCGATGGAAACTCGTCGTCACCTTCGAGTATGATTACCAGTCTTCCTGTA
CCTACAGGAACAGTTGTTCAAATCGGAGACGACGAAGATCAACGAGCTAATGGTAAAATCGTTCGATTACCTCCC
GAGTGTGGTAAACAAGCTTTCGGACGTATAGCCAACACCTGGACACACACAGACCAAACTCTCCCTCCCTCCATC
TCCAAACGCCTAAACCTCCCCCTTCACCGCCGTACCAAACACCATCACAAAATCAAAGGCCTCACCATTGACACC
CAATTCCAAAAAACCGACCGCTCTAAATTCGGTGACGTCAAATTCGCAATTGTAGGCGCTAATGTGCCAGGAGCG
AAAGCGTCGGAAGATTTGAATGTTAATGAACTTGGGGAGAGGAAGAGATATTTTGTTTATTCGAGGGTGTTTAGA
CAAAGGAGGGGATTTGGTGATTTTATTGATGATGTGGGGGGTGCTATAAGTGACGGCGCAGTAGCAGTGGGCGGT
GCTATTAGTGATGGCGTGGGAGCAGTTGGCGAAGTTATCAGCGATGGTGCCGGCGCAGTTGGTGGCGCTATTAGC
GACGGTGTTGACGCGGTTGGCGAAGTTATCAGCGATGGTGCCGGCGCAGTGGGTGATGCTATAAGTGATGGCGCT
GGTGCAGTTGGTGATGTTATTGATAACGTGGGCGGGGCTATCAGCGACGGCGCAGAAGCAGTCGGCGGTGCCATA
GCCAATGGCGCAGAAGCAGTCAGCGACGCCCTTTCCGAACCCCAAGAAATCAGCAAAACCTTTTCCGCCCCCTTC
GACATCAGCAACACCTTCACCGTCTTTGAACAAAACATCAAATGTTCAGCTCCAATCACCAACACAAACACCTCA
ATAAATCCCAAAATCGGAGTAAATGGAAAACTCAAGGTCGATGTAGAGGCGGATGTACATGGAAATGTGGATATT
AGTATTTTTGCGAGTGGATCGTTGACGGAATTGAAATTGGATAAATTCGAGTTGAGCACTAGTTTGAATGCGGAT
TTGAATGGGGCGATTATCTTGTCAGCTGGGGTGGGTGGGTCCATCGAATCCGGAAATATCAAGCTTTTCGAAGTC
GGACCTACGTTCCAAATCAACGCTAATGCCAAGGCGTCGCTGAACATTGACACCGATATGCGGATTGGCGTTGCA
TATCATATTGATAACGCCAAGTTTGATTTCCCGAATGGGGGAAAGAAAAGTGGATCGTTTAGTGCTGGGGATACA
CCACTTCAAATATCGGCGCAACCGTCATCTTCAGCAACAGGCACAGTCGAAGCGCATCTGATTCCAAGTCTGAAC
GTGGGTATAGATGCGTTTGGAGGAGTGGCCAAGGCGGGAGTGTTTGTGAATTTGGATGCGTCGGCAAGTGTGAGT
TTGACGGTGGATGCGACGGGGCCGGTTGTAGAGGGGAAAGTGAATCGGCGGGAAATGATGGTGCGGGGAGGGGGA
GCTATTGGAGCGTATTATTTTAATGATAAGCGGACGCCTGTACCTGAGCCGTTTGGATTTGGGGATATTGTGGAT
GGGATCAAGGATGGAGCGAAGAAAGCTGCGGGGGCGGTGAAGAGTGGGGCCAAGAAGGCTGCTGGTGCGGTCGAG
AGCGGTGCAAAAAAGGTTGTTGACGGAGCGAAAAAAGCAGTTGAAAATGGAGAGAAGAAAGTAGCTGGGGCGGTG
AAAGAAGGAGCGAAAAAGATTGAAAAAGGTGCAAAGAAAGTTGGCGGAGCGGTCAAGGAGGGAGCAGAAAAAGTG
GAAGAGGGCGCCAAAAAGGTCGCCAAAAAGGTTGAAGACGGTGCCAAGAAGGCGGGCAAAGCTGTGAAAGAAGGT
GCCGAAAAGGTCGAAGAGGGTGCTAAGAAGGTAGTTAAAGAGGGCGCCAAAAAGGTCGAGGAAGGAGCCAAGAAA
GCAGGCAAAGCTGTGAAAGAGGGCGCGGAGAAGGTCGAGGAAGGTGCCAAAAAGGTAGTTAAAGAGGGTGCCAAA
AAAGTGGAAGAGGGAGCCAAGAAGGCAGGTAAAGTTGTTAAGGAGGGAGCCGAAAAAGTGGAAGAAGGTGCGAAG
AAGGCGGGTAAAGCTGTGAAAGACGGCGCCGAAAAGGTCGAAGACGGCGCTAAAAAGATAGTCAAAGAGGGCGCC
GAAAAGGTCGAGGAAGGTGCGAAGAAGGCGGGTAAGGCTGTGAAAGCGGGCGCCGAAAAGGTTGAGGAAGGTGCC
AAGAAGATAGTCAAGGAGAAAGCAGAAAAAGTGGAAGAGGCAGGTAAAGTGATTAAAGAAGGAGCAGAAAAGGTC
GGGGAGGTAGTCAAAGAGGGCGCCGAAAAGGTTGAGGAAGGCGTCAAGAAGGCAGGAAAAGTGATTGATGAAGGC
GCCAAGAAGATAGTCAACGGGAAAGTCGAGAAAGAAGGAGCAGAAAAAGTGGAGAAAGGTGCCAAGGAGGATGCC
AAGAAAGAGGACGCCAAGACAGGGGGAGCAACGGATGACGTCAGCTTTGGGGGATGCGTCGAGGTGGGCGCGGGG
TTGTCGGTGAACGTCGGAGCCGATGCCAACTTTTTCGGGCTGTTCGATCCGTTGAAGAAGATTCCGCTGTTTGAG
AAGCAGTTTTCGTTGCTCAAGACATGTTTTGGAGAACAGAAGCGACGGGACCTGAGTGTGGTAGGCCGGGGACTG
ACGTGTAATGGAGTGAATGTTCGCGGGGTAGTCGAGTTGTGCGGTGTTTGGTTCCTCTGGGCAGCCATGGAGGCG
GTCTACCAAGTCAAACTTCTCGCCGCCCTCAGATCAGGCGATCCAGCGCGGATCCACCCCTTTCTGGCTGAAATT
GGCAAGGACCGGTCGGTGTCGTCTCTCGACTGTTCAGCTGCAGCTCTCCACCTCGCCGTCCGATGTGCCTCCACC
GAGACGGTCGCCCTCCTTCTCGCCCACCGTGCCATCTCGCCCAACGGTGTTCACCCCCCCGCCTCGGGCACCACG
CCCCTCCACCTCGCCGCCTCCCTTGGCAGAGTCGACATCGTCACCCTCCTCCTCGACCAGGACGGCATCGACGAT
ACCCTCCTCGACGACCAGCGCAAGTCCTGCCGCGACCTCGCCAAAACCAGAGACACCCTCAAAGCCATCGATGAC
TCACGCACCCTTCTCAATGCCTCTTACCGCTCCCTCCTCCGCTCCTACATCCTCTCCCCCTTCACCGACCCTCCC
TCTCCTGCACTCCTCCACCTCCTCAGCGGACCCCGGACCTCCCTCATCAACCTCTCCTATCTCGACGACGATTCT
GGTTCCTCTCTCTTGCACGAAGCCGCCAACAGAAAGGATCTCCGTCTCATCGAGCTCGCCGTCCGCGCCGGCGCA
GATGTCTTTGTCCGCAACCGCAGGGGAAAGATGGCCTATGAGATCGTCAAGGATGACAAGGTCAAGGTATTCCTA
CGTCAATTCGCCAATCACGATCACTCCTTCATTCGATCCTCCTTCTCCGCTTCAGATCCACCCGCACTCAAGGGC
TATCTCAACAAATACACCAACGTCGCCAGGGGCTACCACACCCGCTGGTTTGTCCTCGCCCATGGTGTCCTCTCA
TACTACCGTCACCAGCAAGACGAGTCTGTATCGTCTCGCGGCTCCATTTCCATGAAATCTGCCATCGTCAAAATC
AACGAACAACACCGCAATAGATTCGAAATCCAGTCCCGACTCGCTTCTGCCTCGGTCCAAAAATGGTACATTAAA
GCAAATCACCCTGTCGAAGCCGCACGTTGGATTCTCGCTCTCAACAAAAGCATAGAATGGGCTAGAGCCGCACCG
GAACCTCCTAGATCCAGTGCTGAAAGGAGTATTGCCGAGTCCGATTCCATCCATGCTGCCCTCAGCACCGACCCT
AATTTGTCGGATATCAATCCGGATGAGGATGAGGAAGAGGGGACAAGGATGCCGACGGATGATGCGTCTTCAATG
GGGATGGTGTCTCGTCATGACGACATTTATGAACTTCAAGGAAACTCGATTTTGGCTCAGCTGGAGATGACACAG
AGGTTGCTCGTGTCTTATTTTGGAGGTTCGACGTCCTCTGCGCGGTCGATCAGTTCGACCCATTCGACGAGTCAA
GAAATCAAGTCTACTATCCTTGAATCCATGTCTACCCTGTCTACTCTTGCGCAAGAATATACGTCCATGTCGAAA
GACCGTGAACAGTGTTTTCAGAAAGCGCTCGCTCAGGAAAAAGCGAGACAGAAGGTGTGGGAAGAGTCCTTGGCG
ACGGTCGTCAGAGAGGGGGCGACGTTGGAAGAAGAGTTGAGGAATAGGAGTAGGAAGAGGGGGTCTAAAATTTTT
GGACCTGGGGAAGGGTTTGTTGCCGCTTTGAGCGGCATTGGGGAGGAGAAGGAAAGTGCTTTGGGAGTGACGTTG
GTCGCTTCCCCTCCTGCCATTGACAGTCCGTGGCAAGAGTCGCCGTTGGCGGAACCCGTTCGACCACGAACGTCG
ACGAATGAAACGGTGAAACCGCGTCAGGATGGGGATTCGGATGAAGAAGACGAGGAAGATGAATTTTTTGATGCA
ATTGATTCGAACAATCTACCTCATCTCGTTGTCCCTCCTTCCCTTGCCGTCATCTCCCCCACCACTTCGCCTCAT
CCAGCCTCCCCCACCAAAGTCAAACTACCGCCGACAGCACAGATTCAACCACCACCCCTATCCCCCGCATTTATA
CCGTCGTTTATTGATATGGGACCCTACAAGGGGTATGAGGTGTTGAGGACCAAATTGGGATTGATGGACGATGAG
AGGCCGCCGACGAGTTTGTGGAGTGTGTTGAAACATTCGATTGGGAAGGATTTGACGAGGATTAGTTTTCCCGTC
TTTTTTAATGAGCCGACGAGTATGTTGCAGAGGATGGCGGAGGATATGGAGTTTAGTGAGTGTTTGGATACGGCC
GCGACGGAGATGGAGTCGTTGAAGCGGTTGGCTTATGTCGCTGCTTTTGCGATGAGTAATTATTCGAGTACGATT
GGGAGGATTGCGAAACCGTTTAATCCGATGTTGAGCGAGACGTTTGAGTATGTGAGGTTGGACAAGAAATATCGG
TATGTGTCGGAACAAGTCAGTCATCATCCACCGATTTCGGCGTGTTGGGCAGAATCGCCTTTGTGGCATTATTTT
GGAGAGGTGGATGCGCAAAACAAGTTTATGGGTAAATCGTTTGAGATTAGACCTACGGGTGTGGCGCATGCTGAA
TTGATTTTACCGGAATCGTGGGTGGAGGAGGATAAGAAAGGGTATAGAAAGGCGCAAGGGGTGTGTGGGGGAGAG
GGAAAGGTGGTGGAACATTATACGTGGAAAAAGGTGACGACGAATGTGTCGGGGTTTATTTTGGGGAGTCCGACG
ATTGATCATTATGGAGATATGACTGTGGTGAATCATGCTACGAATGAGAAATGTGTATTGACGTTTAAACCACGT
GGATGGAGGGGTAAAGATGCGTATGAGATTGCGGGACAGGTGTTGGATGCGAAAGGGAGGGCTGTGTATGAGATT
GCGGGGAGGTGGAATTCACAGTTGATTATGAGGCCTGTGGGGAGTGGGGGAGTGTTGCATCCTGATACGACAGTG
TCGTCTTCGTCTTTGGATGATTTGGAACTCAACACCAACAACAACAACAGTCCGGAATATACTCTGCTATGGAAA
AACTCACCGAAACCGATTGGGTCTCCGTTCAACTTGACACCGTTTGCGATTACGTTGAATGAATGTTCGAAAGAG
ACGCTTTTACCGTTTTTGTGTCCGACGGATTGTAGATTGAGACCGGATCAGAGGGCGTTTGAGATGGGGAAATAT
GATTTGGCGAATGAGTTGAAGATGAGGCAGGAAGAGAGGCAGAGGGGGACGAGGAAGGAGAGGGAGATGGGGGTG
AGGGGGGAACATAGGCCGAGGTGGTTTGAGGCGAGGACGGATGGGGATACGGGGGAGAGGGTGTGGATGCCGAAA
AAGGTGATGGTGGAGTTTAGGGTGGGGAGTGAGGAGGGGGAGGGGGAGGAGGTGAGGAGGAGGGAGGAGGAGGTT
GAGTATTGGGCGGAGAGGGAGAGGGTTTGGAGGGAGGGTGGGTTTAAGAGGTGGAAGGATGTGGAGGAGATATTT
GTGGAGGAGCCGGAGGTTTTGAGGGACTGA
Gene >Agabi119p4|033400
ATGTTAAATCCCCGATTCTCCTCTCTCCTCTTCCTCTCCCTCTATTCAACATCCATCCTCGCATCAAACGACTGG
TCCAAACCCTGTTTCAACGGTATCTGTTCCTACGATCTACCCTACACCCCCTCCGGTCCATCCGGCACACTCAAA
ATCGTACGTTCATCTCCATGAGTATCACCATATATATATATAAATCCCTAATTATTTATAGTGGGGATCCAATAC
CGCCATAGCGGATATAACAACTGCAGGAGGATGGGAAATCATAGGCTGCGATCCGGATAAAGAAGAACAAGATAT
CAAAATCGTGTGTAAAGGTATAGATGTCGACGGTGACGGCGATAATGACGGTTGTGCGCATTTATTCGCTACTAC
TACTACTGGCGATGGAAACTCGTCGTCACCTTCGAGTATGATTACCAGTCTTCCTGTACCTACAGGAACAGTTGT
TCAAATCGGAGACGACGAAGATCAACGAGCTAATGGTAAAATCGTTCGATTACCTCCCGAGGTAAGCATAATGCA
TAAACCCAACAAAAAATATATATATTGACTAAAACTATTGTAATATACAGTGTGGTAAACAAGCTTTCGGACGTA
TAGCCAACACCTGGACACACACAGACCAAACTCTCCCTCCCTCCATCTCCAAACGCCTAAACCTCCCCCTTCACC
GCCGTACCAAACACCATCACAAAATCAAAGGCCTCACCATTGACACCCAATTCCAAAAAACCGACCGCTCTAAAT
TCGGTGACGTCAAATTCGCAATTGTAGGCGCTAATGTGCCAGGAGCGAAAGCGTCGGAAGATTTGAATGTTAATG
AACTTGGGGAGAGGAAGAGATATTTTGTTTATTCGAGGGTGTTTAGACAAAGGAGGGGATTTGGTGATTTTATTG
ATGATGTGGGGGGTGCTATAAGTGACGGCGCAGTAGCAGTGGGCGGTGCTATTAGTGATGGCGTGGGAGCAGTTG
GCGAAGTTATCAGCGATGGTGCCGGCGCAGTTGGTGGCGCTATTAGCGACGGTGTTGACGCGGTTGGCGAAGTTA
TCAGCGATGGTGCCGGCGCAGTGGGTGATGCTATAAGTGATGGCGCTGGTGCAGTTGGTGATGTTATTGATAACG
TGGGCGGGGCTATCAGCGACGGCGCAGAAGCAGTCGGCGGTGCCATAGCCAATGGCGCAGAAGCAGTCAGCGACG
CCCTTTCCGAACCCCAAGAAATCAGCAAAACCTTTTCCGCCCCCTTCGACATCAGCAACACCTTCACCGTCTTTG
AACAAAACATCAAATGTTCAGCTCCAATCACCAACACAAACACCTCAATAAATCCCAAAATCGGAGTAAATGGAA
AACTCAAGGTCGATGTAGAGGCGGATGTACATGGAAATGTGGATATTAGTATTTTTGCGAGTGGATCGTTGACGG
AATTGAAATTGGATAAATTCGAGTTGAGCACTAGTGAGTGATGATATCTGTGTGATTAAAGGTCGCTAAAATCGT
TTTTTTATAGGTTTGAATGCGGATTTGAATGGGGCGATTATCTTGTCAGCTGGGGTGGGTGGGTCCATCGAATCC
GGAAATATCAAGCTTTTCGAAGTCGGTATCCCCGGACTCGATTTCCCTGGGCAAGTGAAATATATAAATGAAGAA
TGACGTACTAACGATAGTCAAACAGGATATTCTCGATAGGACCTACGTTCCAAATCAACGCTAATGCCAAGGCGT
CGCTGAACATTGACACCGATATGCGGATTGGCGTTGCATATCATATTGATAACGCCAAGTTTGATTTCCCGAATG
GGGGAAAGAAAAGTGGATCGTTTAGTGCTGGGGATACACGTACGTGAAATGAATTTCGAACAAATGCAAGACACT
TAGCTTCATTTCAGCACTTCAAATATCGGCGCAACCGTCATCTTCAGCAACAGGCACAGTCGAAGCGCATCTGAT
TCCAAGTCTGAACGTGGGTATAGATGCGTTTGGAGGAGTGGCCAAGGCGGGAGTGTTTGTGAATTTGGATGCGTC
GGCAAGTGTGAGTTTGACGGTGGATGCGACGGGGCCGGTTGTAGAGGGGAAAGTGAATCGGCGGGAAATGATGGT
GCGGGGAGGGGGAGCTATTGGAGCGTATTATTTTAATGATAAGCGGACGCCTGTACCTGAGCCGTTTGGATTTGG
GGATATTGTGGATGGGATCAAGGATGGAGCGAAGAAAGCTGCGGGGGCGGTGAAGAGTGGGGCCAAGAAGGCTGC
TGGTGCGGTCGAGAGCGGTGCAAAAAAGGTTGTTGACGGAGCGAAAAAAGCAGTTGAAAATGGAGAGAAGAAAGT
AGCTGGGGCGGTGAAAGAAGGAGCGAAAAAGATTGAAAAAGGTGCAAAGAAAGTTGGCGGAGCGGTCAAGGAGGG
AGCAGAAAAAGTGGAAGAGGGCGCCAAAAAGGTCGCCAAAAAGGTTGAAGACGGTGCCAAGAAGGCGGGCAAAGC
TGTGAAAGAAGGTGCCGAAAAGGTCGAAGAGGGTGCTAAGAAGGTAGTTAAAGAGGGCGCCAAAAAGGTCGAGGA
AGGAGCCAAGAAAGCAGGCAAAGCTGTGAAAGAGGGCGCGGAGAAGGTCGAGGAAGGTGCCAAAAAGGTAGTTAA
AGAGGGTGCCAAAAAAGTGGAAGAGGGAGCCAAGAAGGCAGGTAAAGTTGTTAAGGAGGGAGCCGAAAAAGTGGA
AGAAGGTGCGAAGAAGGCGGGTAAAGCTGTGAAAGACGGCGCCGAAAAGGTCGAAGACGGCGCTAAAAAGATAGT
CAAAGAGGGCGCCGAAAAGGTCGAGGAAGGTGCGAAGAAGGCGGGTAAGGCTGTGAAAGCGGGCGCCGAAAAGGT
TGAGGAAGGTGCCAAGAAGATAGTCAAGGAGAAAGCAGAAAAAGTGGAAGAGGCAGGTAAAGTGATTAAAGAAGG
AGCAGAAAAGGTCGGGGAGGTAGTCAAAGAGGGCGCCGAAAAGGTTGAGGAAGGCGTCAAGAAGGCAGGAAAAGT
GATTGATGAAGGCGCCAAGAAGATAGTCAACGGGAAAGTCGAGAAAGAAGGAGCAGAAAAAGTGGAGAAAGGTGC
CAAGGAGGATGCCAAGAAAGAGGACGCCAAGACAGGGGGAGCAACGGATGACGTCAGCTTTGGGGGATGCGTCGA
GGTGGGCGCGGGGTTGTCGGTGAACGTCGGAGCCGATGCCAACTTTTTCGGGCTGTTCGATCCGTTGAAGAAGAT
TCCGCTGTTTGAGAAGCAGTTTTCGTTGCTCAAGGTATGTGGTTAGTGAGGATGATGTGCCTGTGCTGACTCGGG
AGCAGACATGTTTTGGAGAACAGAAGCGACGGGACCTGAGTGTGGTAGGCCGGGGACTGACGTGTAATGGAGTGA
ATGTTCGCGGGGTAGTCGAGTTGGTAAATGAGGTAGTGCAGTCACGTGTATGAGTAGGGAGATAAAGCAGTGCGG
TGTTTGGTTCCTCTGGGCAGCCATGGAGGCGGTCTACCAAGTCAAACTTCTCGCCGCCCTCAGATCAGGTTGGTC
GTTTTAGAGTGTAAGAACATCACACTCAGACTGTTGCAGGCGATCCAGCGCGGATCCACCCCTTTCTGGCTGAAA
TTGGCAAGGACCGGTCGGTGTCGTCTCTCGACTGTTCAGCTGCAGCTCTCCACCTCGCCGTCCGATGTGCCTCCA
GTGCGTTTCTTGTTGTTAATCGACTTGTATCTTACTGTGTTTGCAGCCGAGACGGTCGCCCTCCTTCTCGCCCAC
CGTGCCATCTCGCCCAACGGTGTTCACCCCCCCGCCTCGGGCACCACGCCCCTCCACCTCGCCGCCTCCCTTGGC
AGAGTCGACATCGTCACCCTCCTCCTCGACCAGGACGGCATCGACGATACCCTCCTCGACGACCAGCGCAAGTCC
TGCCGCGACCTCGCCAAAACCAGAGACACCCTCAAAGCCATCGATGGTCTGTCACCTCTCTCACAATGATCTCTA
CTCACCCCCTATCCAGACTCACGCACCCTTCTCAATGCCTCTTACCGCTCCCTCCTCCGCTCCTACATCCTCTCC
CCCTTCACCGACCCTCCCTCTCCTGCACTCCTCCACCTCCTCAGCGGACCCCGGACCTCCCTCATCAACCTCTCC
TATCTCGACGACGATTCTGGTTCCTCTCTCTTGCACGAAGCCGCCAACAGAAAGGATCTCCGTCTCATCGAGCTC
GCCGTCCGCGCCGGCGCAGATGTCTTTGTCCGCAACCGCAGGGGAAAGATGGCCTATGAGATCGTCAAGGATGAC
AAGGTCAAGGTATTCCTACGTCAATGTGAGTCTCTTTTTCTCCCCTCACACCCTCACTCATCTCCTTCAGTCGCC
AATCACGATCACTCCTTCATTCGATCCTCCTTCTCCGCTTCAGATCCACCCGCACTCAAGGGCTATCTCAACAAA
TACACCAACGTCGCCAGGGGCTACCACACCCGCTGGTTTGTCCTCGCCCATGGTGTCCTCTCATGCAAGTTCCTT
CTCCTCCCCTTCACCCTCTTTTTAATATCCCCCTCTAGACTACCGTCACCAGCAAGACGAGTCTGTATCGTCTCG
CGGCTCCATTTCCATGAAATCTGCCATCGTCAAAATCAACGAACAACACCGCAATAGATTCGAAATCCAGTCCCG
ACTCGCTTCTGCCTCGGTCCAAAAATGGTACATTAAAGCAAATCACCCTGTCGAAGCCGCACGTTGGATTCTCGC
TCTCAACAAAAGCATAGAATGGGCTAGAGCCGCACCGGAACCTCCTAGATCCAGTGCTGAAAGGAGTATTGCCGA
GTCCGATTCCATCCATGCTGCCCTCAGCACCGACCCTAATTTGTCGGATATCAATCCGGATGAGGATGAGGAAGA
GGGGACAAGGATGCCGACGGATGATGCGTCTTCAATGGGGATGGTGTCTCGTCATGACGACATTTATGAACTTCA
AGGAAACTCGATTTTGGCTCAGCTGGAGATGACACAGAGGTTGCTCGTGTCTTATTTTGGAGGTTCGACGTCCTC
TGCGCGGTCGATCAGTTCGACCCATTCGACGAGTCAAGAAATCAAGTCTACTATCCTTGAATCCATGTCTACCCT
GTCTACTCTTGCGCAAGAATATACGTCCATGTCGAAAGACCGTGAACAGTGTTTTCAGAAAGCGCTCGCTCAGGA
AAAAGCGAGACAGAAGGTGTGGGAAGAGTCCTTGGCGACGGTCGTCAGAGAGGGGGCGACGTTGGAAGAAGAGTT
GAGGAATAGGAGTAGGAAGAGGGGGTCTAAAATTTTTGGACCTGGGGAAGGGTTTGTTGCCGCTTTGAGCGGCAT
TGGGGAGGAGAAGGAAAGTGCTTTGGGAGTGACGTTGGTCGCTTCCCCTCCTGCCATTGACAGTCCGTGGCAAGA
GTCGCCGTTGGCGGAACCCGTTCGACCACGAACGTCGACGAATGAAACGGTGAAACCGCGTCAGGATGGGGATTC
GGATGAAGAAGACGAGGAAGATGAATTTTTTGATGCAATTGATTCGAACAATCTACCTCATCTCGTTGTCCCTCC
TTCCCTTGCCGTCATCTCCCCCACCACTTCGCCTCATCCAGCCTCCCCCACCAAAGTCAAACTACCGCCGACAGC
ACAGATTCAACCACCACCCCTATCCCCCGCATTTATACCGTCGTTTATTGATATGGGACCCTACAAGGGGTATGA
GGTGTTGAGGACCAAATTGGGATTGATGGACGATGAGAGGCCGCCGACGAGTTTGTGGAGTGTGTTGAAACATTC
GATTGGGAAGGATTTGACGAGGATTAGTTTTCCCGTCTTTTTTAATGAGCCGACGAGTATGTTGCAGAGGATGGC
GGAGGATATGGAGTTTAGTGAGTGTTTGGATACGGCCGCGACGGAGATGGAGTCGTTGAAGCGGTTGGCTTATGT
CGCTGCTTTTGCGATGAGTAATTATTCGAGTACGATTGGGAGGATTGCGAAACCGTTTAATCCGATGTTGGTGAG
TCGCGGTTTTGTTTATATATTTGATGATGGTTGACACCTCTTTGAAAGAGCGAGACGTTTGAGTATGTGAGGTTG
GACAAGAAATATCGGTATGTGTCGGAACAAGTCAGTCATCATCCACCGATTTCGGCGTGTTGGGCAGAATCGCCT
TTGTGGCATTATTTTGGAGAGGTGGATGCGCAAAACAAGTTTATGGGTAAATCGTTTGAGATTAGACCTACGGGT
GTGGCGCATGCTGAATTGATTTTACCGGAATCGTGGGTGGAGGAGGATAAGAAAGGGTATAGAAAGGCGCAAGGG
GTGTGTGGGGGAGAGGGAAAGGTGGTGGAACATTATACGTGGAAAAAGGTGACGACGAATGTGTCGGGGTTTATT
TTGGGGAGTCCGACGATTGATCATTATGGAGATATGACTGTGAGTTGTTTCTCTCGCTGTGTGATCAGGATCCAT
AATAATGACACTTTGACAGGTGGTGAATCATGCTACGAATGAGAAATGTGTATTGACGTTTAAACCACGTGGATG
GAGGGGTAAAGATGCGTATGAGATTGCGGGACAGGTGTTGGATGCGAAAGGGAGGGCTGTGTATGAGATTGCGGG
GAGGTGGAATTCACAGTTGATTATGAGGCCTGTGGGGAGTGGGGGAGTGTTGCATCCTGATACGACAGTGTCGTC
TTCGTCTTTGGATGATTTGGAACTCAACACCAACAACAACAACAGTCCGGAATATACTCTGCTATGGAAAAACTC
ACCGAAACCGATTGGGTCTCCGTTCAACTTGACACCGTTTGCGATTACGTTGAATGAATGTTCGAAAGAGACGCT
TTTACCGTTTTTGTGTCCGACGGATTGTAGATTGAGACCGGATCAGAGGGCGTTTGAGATGGGGAAATATGATTT
GGCGAATGAGTTGAAGATGAGGCAGGAAGAGAGGCAGAGGGGGACGAGGAAGGAGAGGGAGATGGGGGTGAGGGG
GGAACATAGGCCGAGGTGGTTTGAGGCGAGGACGGATGGGGATACGGGGGAGAGGGTGTGGATGCCGAAAAAGGT
GATGGTGGAGTTTAGGGTGGGGAGTGAGGAGGGGGAGGGGGAGGAGGTGAGGAGGAGGGAGGAGGAGGTTGAGTA
TTGGGCGGAGAGGGAGAGGGTTTGGAGGGAGGGTGGGTTTAAGAGGTGGAAGGATGTGGAGGAGATATTTGTGGA
GGAGCCGGAGGTTTTGAGGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail