Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|032940
Gene name
Locationscaffold_12:1380562..1383621
Strand-
Gene length (bp)3059
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 8.0E-44 312 816
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 6.8E-05 38 73
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 1.7E-18 185 258
PF00627 UBA UBA/TS-N domain 5.6E-10 614 650
PF00627 UBA UBA/TS-N domain 5.6E-09 682 716
PF17807 zf-UBP_var Variant UBP zinc finger 7.7E-19 18 78
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 6.5E-13 313 796

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11119|UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp14 PE=1 SV=2 1 819 0.0E+00
sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 6 819 5.0E-161
sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 6 819 1.0E-160
sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 6 819 1.0E-159
sp|P54201|UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum GN=ubpA PE=2 SV=2 8 818 1.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11119|UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp14 PE=1 SV=2 1 819 0.0E+00
sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 6 819 5.0E-161
sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 6 819 1.0E-160
sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 6 819 1.0E-159
sp|P54201|UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum GN=ubpA PE=2 SV=2 8 818 1.0E-138
sp|F1QFS9|UBP13_DANRE Ubiquitin carboxyl-terminal hydrolase 13 OS=Danio rerio GN=usp13 PE=2 SV=1 12 819 1.0E-137
sp|Q8L6Y1|UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana GN=UBP14 PE=1 SV=1 12 819 3.0E-135
sp|E1BY77|UBP13_CHICK Ubiquitin carboxyl-terminal hydrolase 13 OS=Gallus gallus GN=USP13 PE=3 SV=1 12 819 6.0E-134
sp|Q92995|UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens GN=USP13 PE=1 SV=2 1 819 2.0E-132
sp|Q5BKP2|UBP13_MOUSE Ubiquitin carboxyl-terminal hydrolase 13 OS=Mus musculus GN=Usp13 PE=1 SV=1 1 819 3.0E-132
sp|E1BMF7|UBP13_BOVIN Ubiquitin carboxyl-terminal hydrolase 13 OS=Bos taurus GN=USP13 PE=3 SV=2 1 819 2.0E-131
sp|F6V6I0|UBP13_XENTR Ubiquitin carboxyl-terminal hydrolase 13 OS=Xenopus tropicalis GN=usp13 PE=3 SV=2 12 819 2.0E-112
sp|P38237|UBP14_YEAST Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP14 PE=1 SV=2 9 818 1.0E-107
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 185 580 2.0E-14
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 185 580 3.0E-14
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 197 580 4.0E-13
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 195 580 3.0E-12
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 304 584 5.0E-12
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 308 584 2.0E-11
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 303 580 1.0E-10
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 313 575 1.0E-09
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 181 468 2.0E-09
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 614 690 5.0E-09
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 617 668 7.0E-09
sp|B3M3M6|UBP36_DROAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila ananassae GN=Usp36 PE=3 SV=1 312 598 9.0E-09
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 617 668 1.0E-08
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 313 582 1.0E-08
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 163 252 1.0E-08
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 617 666 2.0E-08
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 184 252 2.0E-08
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 312 608 2.0E-08
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 181 450 2.0E-08
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 617 666 3.0E-08
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 185 467 3.0E-08
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 618 670 4.0E-08
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 310 506 5.0E-08
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 185 462 6.0E-08
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 163 252 1.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 163 252 1.0E-07
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 305 564 1.0E-07
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 618 673 2.0E-07
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 185 466 2.0E-07
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 163 252 2.0E-07
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 163 252 2.0E-07
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 185 450 2.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 294 564 2.0E-07
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 183 462 3.0E-07
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 614 670 3.0E-07
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 163 252 1.0E-06
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 185 450 2.0E-06
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 162 236 2.0E-06
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 185 450 3.0E-06
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 186 455 4.0E-06
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 181 450 4.0E-06
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 310 456 5.0E-06
sp|Q28DG7|UBAC1_XENTR Ubiquitin-associated domain-containing protein 1 OS=Xenopus tropicalis GN=ubac1 PE=2 SV=1 617 717 8.0E-06
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 305 564 9.0E-06
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 176 267 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0008270 zinc ion binding Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0019538 protein metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0008233 peptidase activity No
GO:0043169 cation binding No
GO:0008234 cysteine-type peptidase activity No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0006508 proteolysis No
GO:0043167 ion binding No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0019783 ubiquitin-like protein peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|032940
MACPHLDQVKNIRAPTVQAVHREECTLCFDGQDSDSGVDVCLTCFNGGCLGNDRNHAQLHYEKSHHLFTLNVRRK
LKPNAHRADEEEPPTKMKKLAITEEREEDKYDHTLTLKCWLCEATAGSVIPDALQDPKIKSLADGVMSSLSSARQ
SEVKAWEEEITACEHTLLLQQESSGPIEASGLAHCRSCDLKENLWLCMTCGSLGCGRQLYGGIGGNGHGLDHFKE
SGHPVSVKLGTITPEGEADIFCYICDETRQDPELSAHLSTFGINVRSLSKTEKSMTELQIEHNLRYDFSLTNEDG
TALEPVFGRGLTGLQNLGNSCYMASVLQTLFSLRQFQERYKTAHAIAHTRACEKLPADCLECQMYKVADGLLSGR
YSVPASGDSPKSSVGQGGEGGGLLHQSPTPVFQNGVRPATLKAVIGKGHAEFSTMRQQDSEEFLTHLLNTLRRDI
HKYKQQDPSIEDVTRTFSYGWEQRLQCADCKKVKYITEEADVVSVSVPANEKGKMEDGKVIYEDVLLEKCLETLL
GTEALEYKCPSCNKTVHAIKQTRFATFPETLVVHAKKFQLVNWVPAKLDIPVILPQGDILEFEGKHLGSGLQPDE
QQLGEAPPELPQFDAEALGQLLMMGFPEIRCQKALLATGNSNADMALNWLLNHSEDPDIDAPILAPAGSGGGVMQ
SLPEPPEELVSMLADMGFTGMQAKKALRQTDNNMERAVEWLFSHPDDDGSEAPPQTSSQRESKTIYGIQDVPVRY
RLKAFISHKGPSVHSGHYVAHIRKPFVENRGEGGDGDWVLFNDEKVVRADEGSVKELKKLAYLYVFERV*
Coding >Agabi119p4|032940
ATGGCTTGCCCGCATCTGGACCAGGTAAAGAACATCAGAGCGCCGACTGTGCAGGCCGTGCACCGCGAAGAGTGC
ACACTCTGCTTCGATGGCCAGGATTCAGATTCCGGCGTCGATGTCTGCCTGACCTGCTTCAACGGCGGATGCCTA
GGAAACGACAGAAATCACGCCCAGTTGCACTACGAGAAATCGCATCACCTATTCACCCTCAATGTCAGGCGGAAG
CTAAAGCCGAACGCGCATCGTGCGGACGAGGAAGAGCCACCGACAAAAATGAAAAAACTCGCCATCACGGAAGAA
CGCGAGGAGGACAAGTACGACCACACCTTGACCCTCAAATGTTGGCTGTGCGAGGCCACGGCGGGGAGTGTGATT
CCCGATGCGCTACAGGATCCCAAGATCAAATCATTAGCCGATGGTGTCATGTCTTCTCTCTCATCCGCGCGTCAG
TCAGAAGTCAAAGCATGGGAGGAAGAAATCACCGCCTGCGAGCACACTCTCCTGCTCCAACAAGAGTCATCTGGC
CCCATCGAAGCTTCTGGCCTCGCACATTGCCGGTCTTGTGACCTCAAGGAAAACCTTTGGTTATGCATGACCTGT
GGTTCTCTCGGCTGTGGTCGTCAGCTCTATGGCGGTATCGGAGGAAACGGCCACGGATTGGACCACTTTAAAGAG
TCTGGTCATCCTGTCAGCGTCAAGTTAGGAACGATTACACCCGAAGGCGAAGCAGACATCTTTTGCTACATCTGT
GACGAGACGAGACAGGATCCAGAGCTCTCGGCTCACCTCTCCACCTTTGGCATCAACGTCCGCTCCCTCAGCAAA
ACCGAGAAGAGTATGACCGAGCTTCAAATCGAGCATAACCTGCGATATGACTTCTCACTCACCAACGAGGATGGC
ACAGCTCTCGAACCCGTATTCGGTCGCGGCCTTACCGGACTCCAAAATCTGGGCAACTCGTGTTACATGGCTTCA
GTCCTTCAAACCTTATTTTCTCTCAGACAATTCCAAGAACGATACAAAACAGCGCACGCCATCGCTCATACCCGT
GCATGCGAGAAATTACCTGCGGATTGTTTAGAATGTCAGATGTACAAGGTCGCTGACGGGTTGTTAAGTGGGAGG
TATTCTGTTCCTGCGAGTGGTGACTCTCCAAAGTCTTCTGTGGGGCAGGGAGGGGAGGGAGGAGGCTTGTTGCAT
CAATCCCCGACGCCTGTATTTCAGAACGGCGTGAGACCGGCGACGTTGAAAGCTGTTATAGGTAAAGGTCATGCA
GAGTTTTCTACGATGAGGCAACAGGATTCGGAAGAGTTTTTGACTCATCTTTTGAATACGCTTCGAAGAGATATT
CACAAGTATAAACAACAAGATCCCAGTATTGAGGATGTGACGAGGACTTTTTCTTATGGATGGGAACAACGTCTT
CAATGCGCCGATTGCAAGAAAGTGAAATATATCACTGAGGAAGCGGATGTTGTGAGCGTATCTGTGCCGGCTAAC
GAGAAAGGGAAGATGGAGGACGGGAAAGTGATCTATGAAGATGTTTTACTTGAAAAATGTCTGGAGACGCTACTT
GGAACCGAGGCATTAGAGTATAAATGTCCGAGTTGCAACAAGACCGTTCACGCCATCAAGCAAACGCGTTTTGCT
ACATTCCCAGAAACACTTGTCGTCCACGCGAAAAAATTCCAACTCGTCAATTGGGTACCTGCTAAACTTGATATC
CCAGTCATACTTCCTCAAGGCGATATACTTGAATTTGAAGGAAAACATTTGGGTAGTGGTTTACAACCTGATGAA
CAGCAATTGGGTGAAGCTCCGCCGGAGTTACCACAGTTTGATGCGGAAGCTTTGGGACAATTGTTGATGATGGGA
TTTCCAGAGATTCGGTGTCAGAAAGCGTTACTTGCTACGGGGAATAGTAATGCTGATATGGCTTTGAATTGGTTA
TTGAATCATTCTGAGGATCCTGATATTGATGCGCCGATTTTGGCACCGGCGGGATCTGGTGGAGGGGTGATGCAA
TCTTTACCTGAACCTCCGGAGGAATTGGTTTCGATGTTGGCGGATATGGGGTTTACGGGGATGCAAGCTAAAAAG
GCATTACGACAAACTGATAATAATATGGAAAGAGCGGTAGAATGGTTGTTCAGTCATCCTGACGATGATGGTTCC
GAAGCTCCTCCTCAGACGTCTTCTCAACGAGAATCAAAAACGATATATGGAATTCAAGATGTTCCGGTGAGATAT
AGATTGAAAGCGTTTATTTCGCATAAAGGACCTTCGGTTCATTCTGGACATTATGTTGCGCATATTCGGAAACCA
TTTGTTGAGAATAGAGGTGAGGGTGGGGATGGGGATTGGGTTTTGTTTAATGATGAGAAGGTTGTTAGGGCGGAT
GAGGGGAGTGTGAAGGAATTGAAAAAGTTGGCTTATTTGTATGTTTTTGAGAGGGTTTAA
Transcript >Agabi119p4|032940
ATGGCTTGCCCGCATCTGGACCAGGTAAAGAACATCAGAGCGCCGACTGTGCAGGCCGTGCACCGCGAAGAGTGC
ACACTCTGCTTCGATGGCCAGGATTCAGATTCCGGCGTCGATGTCTGCCTGACCTGCTTCAACGGCGGATGCCTA
GGAAACGACAGAAATCACGCCCAGTTGCACTACGAGAAATCGCATCACCTATTCACCCTCAATGTCAGGCGGAAG
CTAAAGCCGAACGCGCATCGTGCGGACGAGGAAGAGCCACCGACAAAAATGAAAAAACTCGCCATCACGGAAGAA
CGCGAGGAGGACAAGTACGACCACACCTTGACCCTCAAATGTTGGCTGTGCGAGGCCACGGCGGGGAGTGTGATT
CCCGATGCGCTACAGGATCCCAAGATCAAATCATTAGCCGATGGTGTCATGTCTTCTCTCTCATCCGCGCGTCAG
TCAGAAGTCAAAGCATGGGAGGAAGAAATCACCGCCTGCGAGCACACTCTCCTGCTCCAACAAGAGTCATCTGGC
CCCATCGAAGCTTCTGGCCTCGCACATTGCCGGTCTTGTGACCTCAAGGAAAACCTTTGGTTATGCATGACCTGT
GGTTCTCTCGGCTGTGGTCGTCAGCTCTATGGCGGTATCGGAGGAAACGGCCACGGATTGGACCACTTTAAAGAG
TCTGGTCATCCTGTCAGCGTCAAGTTAGGAACGATTACACCCGAAGGCGAAGCAGACATCTTTTGCTACATCTGT
GACGAGACGAGACAGGATCCAGAGCTCTCGGCTCACCTCTCCACCTTTGGCATCAACGTCCGCTCCCTCAGCAAA
ACCGAGAAGAGTATGACCGAGCTTCAAATCGAGCATAACCTGCGATATGACTTCTCACTCACCAACGAGGATGGC
ACAGCTCTCGAACCCGTATTCGGTCGCGGCCTTACCGGACTCCAAAATCTGGGCAACTCGTGTTACATGGCTTCA
GTCCTTCAAACCTTATTTTCTCTCAGACAATTCCAAGAACGATACAAAACAGCGCACGCCATCGCTCATACCCGT
GCATGCGAGAAATTACCTGCGGATTGTTTAGAATGTCAGATGTACAAGGTCGCTGACGGGTTGTTAAGTGGGAGG
TATTCTGTTCCTGCGAGTGGTGACTCTCCAAAGTCTTCTGTGGGGCAGGGAGGGGAGGGAGGAGGCTTGTTGCAT
CAATCCCCGACGCCTGTATTTCAGAACGGCGTGAGACCGGCGACGTTGAAAGCTGTTATAGGTAAAGGTCATGCA
GAGTTTTCTACGATGAGGCAACAGGATTCGGAAGAGTTTTTGACTCATCTTTTGAATACGCTTCGAAGAGATATT
CACAAGTATAAACAACAAGATCCCAGTATTGAGGATGTGACGAGGACTTTTTCTTATGGATGGGAACAACGTCTT
CAATGCGCCGATTGCAAGAAAGTGAAATATATCACTGAGGAAGCGGATGTTGTGAGCGTATCTGTGCCGGCTAAC
GAGAAAGGGAAGATGGAGGACGGGAAAGTGATCTATGAAGATGTTTTACTTGAAAAATGTCTGGAGACGCTACTT
GGAACCGAGGCATTAGAGTATAAATGTCCGAGTTGCAACAAGACCGTTCACGCCATCAAGCAAACGCGTTTTGCT
ACATTCCCAGAAACACTTGTCGTCCACGCGAAAAAATTCCAACTCGTCAATTGGGTACCTGCTAAACTTGATATC
CCAGTCATACTTCCTCAAGGCGATATACTTGAATTTGAAGGAAAACATTTGGGTAGTGGTTTACAACCTGATGAA
CAGCAATTGGGTGAAGCTCCGCCGGAGTTACCACAGTTTGATGCGGAAGCTTTGGGACAATTGTTGATGATGGGA
TTTCCAGAGATTCGGTGTCAGAAAGCGTTACTTGCTACGGGGAATAGTAATGCTGATATGGCTTTGAATTGGTTA
TTGAATCATTCTGAGGATCCTGATATTGATGCGCCGATTTTGGCACCGGCGGGATCTGGTGGAGGGGTGATGCAA
TCTTTACCTGAACCTCCGGAGGAATTGGTTTCGATGTTGGCGGATATGGGGTTTACGGGGATGCAAGCTAAAAAG
GCATTACGACAAACTGATAATAATATGGAAAGAGCGGTAGAATGGTTGTTCAGTCATCCTGACGATGATGGTTCC
GAAGCTCCTCCTCAGACGTCTTCTCAACGAGAATCAAAAACGATATATGGAATTCAAGATGTTCCGGTGAGATAT
AGATTGAAAGCGTTTATTTCGCATAAAGGACCTTCGGTTCATTCTGGACATTATGTTGCGCATATTCGGAAACCA
TTTGTTGAGAATAGAGGTGAGGGTGGGGATGGGGATTGGGTTTTGTTTAATGATGAGAAGGTTGTTAGGGCGGAT
GAGGGGAGTGTGAAGGAATTGAAAAAGTTGGCTTATTTGTATGTTTTTGAGAGGGTTTAA
Gene >Agabi119p4|032940
ATGGCTTGCCCGCATCTGGACCAGGTAAAGAACATCAGAGCGCCGACTGTGCAGGCCGTGCACCGCGAAGAGTGC
ACACTCTGCTTCGATGGCCAGGTGAGAAATCTCGGACAAGGGTTGTCATCTGCTTATACCACTTCAGGATTCAGA
TTCCGGCGTCGATGTCTGCCTGACCTGCTTCAACGGCGGATGCCTAGGAAACGACAGAAATCACGCCCAGTTGCA
CTACGAGAAATCGCATCACCTATTCACCCTCAATGTCAGGCGGAAGCTAAAGCCGAACGCGCATCGTGTGTGTGT
TGATCCGTCAAACCTTTACTGATGCATCTCATATTCTGTGCAGGCGGACGAGGAAGAGCCACCGACAAAAATGAA
AAAACTCGCCATCACGGAAGAACGCGAGGAGGACAAGTACGACCACACCTTGACCCTCAAATGTTGGCTGTGCGA
GGCCACGGCGGGGAGTGTGATTCCCGATGCGCTACAGGATCCCAAGGCATGTACACGATCTACATTGTTTTCTTT
TGACCCTGACAGTTTGCAGATCAAATCATTAGCCGATGGTGTCATGTCTTCTCTCTCATCCGCGCGTCAGTCAGA
AGTCAAAGCATGGGAGGAAGAAATCACCGCCTGCGAGCACACTCTCCTGCTCCAACAAGAGTCATCTGGCCCCAT
CGAAGCTTCTGGTATGCGCTCATCACCCCAAAATCCCTCCTTCTCATTTTTGGCTAGGCCTCGCACATTGCCGGT
CTTGTGACCTCAAGGAAAACCTTTGGTTATGCATGACCTGTGGTTCTCTCGGCTGTGGTCGTCAGCTCTATGGCG
GTATCGGAGGAAACGGCCACGGATTGGACCACTTTAAAGAGTCTGGTCATCCTGTCAGCGTCAAGTTAGGAACGA
TTACACCCGAAGGCGAAGCAGGCACGTTATAACGATCCCCTATTCTTTTCATATTGTTAACCATTCCAAAGACAT
CTTTTGCTACATCTGTGACGAGACGAGACAGGATCCAGAGCTCTCGGCTCACCTCTCCACCTTTGGCATCAACGT
CCGCTCCCTCAGCAAAACCGAGAAGAGTATGACCGAGCTTGTTCGTCACCCTCTCACCAGTACAATGCTATCACT
AACTCTATCAATCATCGCAGCAAATCGAGCATAACCTGCGATATGACTTCTCACTCACCAACGAGGATGGCACAG
CTCTCGAACCCGTATTCGGTCGCGGCCTTACCGGACTCCAAAATCTGGGCAACTCGTGTTACATGGCTTCAGTCC
TTCAAACCTTATTTTCTCTCAGACAATTCCAAGAACGATACAAAACAGCGCACGCCATCGCTCATACCCGTGCAT
GCGAGAAATTACCTGCGGATTGTTTAGAATGTCAGATGTACAAGGTCGCTGACGGGTTGTTAAGTGGGAGGTATT
CTGTTCCTGCGAGTGGTGACTCTCCAAAGTCTTCTGTGGGGCAGGGAGGGGAGGGAGGAGGCTTGTTGCATCAAT
CCCCGACGCCTGTATTTCAGAACGGCGTGAGACCGGCGACGTTGAAAGCTGTTATAGGTAAAGGTCATGCAGAGT
TTTCTACGATGAGGCAACAGGATTCGGAAGAGTTTTTGACTCATCTTTTGAATACGCTTCGAAGAGATATTCACA
AGTATAAACAACAAGATCCCAGTGAGATTTTCATTTTCTCAATTGTTCTATAATTCTAATTTGTGTGAAAGGTAT
TGAGGATGTGACGAGGACTTTTTCTTATGGATGGGAACAACGTCTTCAATGCGCCGATTGCAAGAAAGTGAAATA
TATCACTGAGGAAGCGGATGTTGTGAGCGTATCTGTGCCGGCTAACGAGAAAGGGAAGATGGAGGACGGGAAAGT
GATCTATGAAGATGTTTTACTTGAAAAATGTCTGGAGACGCTACTTGGAACCGAGGCATTAGAGTATAAATGTCC
GAGTTGCAACAAGACCGTTCACGCCATCAAGTACGTTCTCCCTTCTCAAGTTGTTTTATCATATTTCATTTTGTA
CTGACTTGGTATCCTAAAATCCACTCAGGCAAACGCGTTTTGCTACATTCCCAGAAACACTTGTCGTCCACGCGA
AAAAATTCCAACTCGTCAATTGGGTACCTGCTAAACTTGATATCCCAGTCATACTTCCTCAAGGCGATATACTTG
AATTTGAAGGAAAACATTTGGGTAGTGGTTTACAACCTGATGAACAGCAATTGGGTGAAGCTCGTAAGTTACCAA
ATTGCTACTGTTATACACATATGCGCTATGTATTTATTGATTTGTTTTGTTAGCGCCGGAGTTACCACAGTTTGA
TGCGGAAGCTTTGGGACAATTGTTGATGATGGGATTTCCAGAGATTCGGTGTCAGAAAGCGTTACTTGCTACGGG
GAATAGTAATGCTGATATGGCTTTGAATTGGTTATTGAATCATTCTGAGGATCCTGGTAAACGTTCTCTATTACC
TACCTTTACGCCACATTGCTAAAAATCCTTTACGACAGATATTGATGCGCCGATTTTGGCACCGGCGGGATCTGG
TGGAGGGGTGATGCAATCTTTACCTGAACCTCCGGAGGAATTGGTTTCGATGTTGGCGGATATGGGGTTTACGGG
GATGCAAGCTAAAAAGGCATTACGACAAACTGTAAGTTTTTGAATCTCTTTTTTAAAAAAATCTTGTTTTTACTG
ATATGGAGGGGAAGGATAATAATATGGAAAGAGCGGTAGAATGGTTGTTCAGTCATCCTGACGATGATGGTTCCG
AAGCTCCTCCTCAGACGTCTTCTCAACGAGAATCAAAAACGATATATGGAATTCAAGATGTTCCGGTGAGATATA
GATTGAAAGCGTTTATTTCGCATAAAGGACCTTCGGTTCATTCTGGACATTATGTTGCGCATATTCGGAAACCAT
TTGTTGAGAATAGAGGTGAGGGTGGGGATGGGGATTGGGTTTTGTTTAATGATGAGAAGGTTGTTAGGGCGGATG
AGGGGAGTGTGAAGGAATTGAAAAAGTTGGCTTATTTGTATGTTTTTGAGAGGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail