Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|032780
Gene name
Locationscaffold_12:1328903..1330415
Strand+
Gene length (bp)1512
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 1.9E-08 58 127
PF02469 Fasciclin Fasciclin domain 2.9E-19 251 378

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B388|FLA_ARTBC Fasciclin-like arabinogalactan protein ARB_02922 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02922 PE=3 SV=1 213 377 4.0E-07
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 262 399 5.0E-07
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 217 399 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|032780
MFSSVAFTLLTVALPTVLAQSSDSGYVQGLVNELNAIGYSGAANALSRANGTSSGQQFLSQVQDGNFTVFVPNNA
AFENLPSNVTSDDDLVAKYLAYHFVYGSFQNTSATNSSGGGGGGTTSSASASESSSTASSTEAFAWYQRRDEVSN
SSDALLSGIYPNTTIGRTLLNSSDLVQLEANKSQVLAWTRIGGGNVTLLNQPNISVANSSTYENLFLNSIDGVIT
PPGNLSTVLNATNATAFVAFAQQVNTTNSDGSNTSAVNSLEQENGFTLFVPDNDAFQAAQQTIGGFQNNQTALKA
LLGNHIINGTTLYTPDFQNATASGSGANYITAAGENLSVSSNSSGIFLQNENGSVAQITRPDVLVSNGVFHVIDN
VLVETDSNPEAASSAVMSASSAATAQSSTDTLPIGGGATLTSAGATSTPALLRFHRAL*
Coding >Agabi119p4|032780
ATGTTCTCTTCGGTTGCTTTCACCTTACTCACTGTCGCTCTCCCTACGGTGCTTGCTCAAAGCTCAGACTCTGGT
TATGTGCAGGGTCTTGTCAATGAGCTGAACGCAATAGGTTACTCCGGAGCTGCGAACGCGCTCAGTCGTGCCAAC
GGTACCAGTAGCGGCCAACAATTTCTGTCGCAGGTACAAGACGGCAATTTTACCGTATTCGTGCCCAACAATGCG
GCTTTCGAGAATTTGCCCAGCAACGTCACGAGTGACGATGACCTCGTCGCGAAATACTTGGCTTATCACTTCGTC
TACGGTAGCTTCCAAAACACGTCCGCTACCAACTCATCTGGTGGCGGTGGCGGTGGCACGACTTCCTCCGCTAGT
GCCAGCGAGTCCTCTTCCACTGCGTCATCCACAGAGGCTTTCGCCTGGTACCAGCGACGAGATGAAGTTTCGAAC
TCATCTGATGCTCTACTCAGTGGCATCTATCCCAATACTACTATTGGTCGCACCCTCCTCAACTCTTCCGATCTT
GTTCAACTGGAGGCCAACAAGTCTCAAGTTCTCGCCTGGACAAGAATCGGCGGCGGTAATGTGACTCTGCTCAAT
CAGCCGAACATTTCTGTTGCAAATTCGTCCACCTACGAGAACTTGTTCCTGAACTCAATTGACGGTGTCATTACC
CCACCTGGCAATCTTTCTACTGTCCTCAATGCGACCAATGCCACTGCCTTCGTCGCCTTCGCCCAGCAAGTGAAC
ACGACCAATTCCGACGGAAGTAACACCTCGGCGGTCAACTCGCTGGAGCAGGAAAATGGGTTCACCCTTTTCGTT
CCCGACAATGACGCGTTCCAGGCGGCTCAGCAGACAATTGGTGGTTTCCAGAACAACCAGACCGCTCTAAAGGCT
CTTCTGGGCAATCACATCATCAACGGCACTACTCTTTACACCCCTGATTTCCAAAACGCCACCGCGTCAGGAAGT
GGTGCTAATTACATCACGGCTGCTGGCGAGAACCTATCCGTTTCGTCCAACTCCTCCGGTATATTCCTTCAGAAT
GAAAACGGTAGTGTTGCCCAGATCACTCGGCCTGATGTTCTCGTCTCAAATGGCGTTTTCCACGTTATCGACAAC
GTCCTCGTGGAGACCGATTCCAATCCCGAAGCAGCCTCCTCTGCTGTGATGTCCGCCTCGTCTGCTGCAACCGCT
CAGAGTTCGACAGACACTCTTCCCATTGGCGGTGGCGCAACCCTCACTTCTGCGGGAGCTACTTCTACTCCTGCT
CTTCTTCGGTTCCATCGCGCTCTGTAA
Transcript >Agabi119p4|032780
ATGTTCTCTTCGGTTGCTTTCACCTTACTCACTGTCGCTCTCCCTACGGTGCTTGCTCAAAGCTCAGACTCTGGT
TATGTGCAGGGTCTTGTCAATGAGCTGAACGCAATAGGTTACTCCGGAGCTGCGAACGCGCTCAGTCGTGCCAAC
GGTACCAGTAGCGGCCAACAATTTCTGTCGCAGGTACAAGACGGCAATTTTACCGTATTCGTGCCCAACAATGCG
GCTTTCGAGAATTTGCCCAGCAACGTCACGAGTGACGATGACCTCGTCGCGAAATACTTGGCTTATCACTTCGTC
TACGGTAGCTTCCAAAACACGTCCGCTACCAACTCATCTGGTGGCGGTGGCGGTGGCACGACTTCCTCCGCTAGT
GCCAGCGAGTCCTCTTCCACTGCGTCATCCACAGAGGCTTTCGCCTGGTACCAGCGACGAGATGAAGTTTCGAAC
TCATCTGATGCTCTACTCAGTGGCATCTATCCCAATACTACTATTGGTCGCACCCTCCTCAACTCTTCCGATCTT
GTTCAACTGGAGGCCAACAAGTCTCAAGTTCTCGCCTGGACAAGAATCGGCGGCGGTAATGTGACTCTGCTCAAT
CAGCCGAACATTTCTGTTGCAAATTCGTCCACCTACGAGAACTTGTTCCTGAACTCAATTGACGGTGTCATTACC
CCACCTGGCAATCTTTCTACTGTCCTCAATGCGACCAATGCCACTGCCTTCGTCGCCTTCGCCCAGCAAGTGAAC
ACGACCAATTCCGACGGAAGTAACACCTCGGCGGTCAACTCGCTGGAGCAGGAAAATGGGTTCACCCTTTTCGTT
CCCGACAATGACGCGTTCCAGGCGGCTCAGCAGACAATTGGTGGTTTCCAGAACAACCAGACCGCTCTAAAGGCT
CTTCTGGGCAATCACATCATCAACGGCACTACTCTTTACACCCCTGATTTCCAAAACGCCACCGCGTCAGGAAGT
GGTGCTAATTACATCACGGCTGCTGGCGAGAACCTATCCGTTTCGTCCAACTCCTCCGGTATATTCCTTCAGAAT
GAAAACGGTAGTGTTGCCCAGATCACTCGGCCTGATGTTCTCGTCTCAAATGGCGTTTTCCACGTTATCGACAAC
GTCCTCGTGGAGACCGATTCCAATCCCGAAGCAGCCTCCTCTGCTGTGATGTCCGCCTCGTCTGCTGCAACCGCT
CAGAGTTCGACAGACACTCTTCCCATTGGCGGTGGCGCAACCCTCACTTCTGCGGGAGCTACTTCTACTCCTGCT
CTTCTTCGGTTCCATCGCGCTCTGTAA
Gene >Agabi119p4|032780
ATGTTCTCTTCGGTTGCTTTCACCTTACTCACTGTCGCTCTCCCTACGGTGCTTGCTCAAAGCTCAGACTCTGGT
TATGTGCAGGGTCTTGTCAATGAGCTGAACGCAATAGGTTACTCCGGAGCTGCGAACGCGCTCAGTCGTGCCAAC
GGTACCAGTAGCGGCCAACAATTTCTGTCGCAGGTACAAGACGGCAATTTTACCGTATTCGTGCCCAACAATGCG
GCTTGTGAGTTATCACTTTACTTTCCATTCGAAAATCTTGTCTGATTCCATTCCCTTTCAGTCGAGAATTTGCCC
AGCAACGTCACGAGTGACGATGACCTCGTCGCGAAATACTTGGCTTATCACTTCGTCTACGGTAGCTTCCAAAAC
ACGTCCGCTACCAACTCATCTGGTGGCGGTGGCGGTGGCACGACTTCCTCCGCTAGTGCCAGCGAGTCCTCTTCC
ACTGCGTCATCCACAGAGGCTTTCGCCTGGTACCAGCGACGAGATGAAGTTTCGAACTCATCTGATGCTCTACTC
AGTGGCATCTATCCCAATACTACTATTGGTCGCACCCTCCTCAACTCTTCCGATCTTGTTCAACTGGAGGCCAAC
AAGTCTCAAGTTCTCGCCTGGACAAGAATCGGCGGCGGTAATGTGACTCTGCTCAATCAGCCGTAAGTCTTCGCC
TTAGGATGCTGAGCAATTTGACTGACATATCCTCTAGGAACATTTCTGTTGCAAATTCGTCCACCTACGAGAACT
TGTTCCTGAACTCAATTGACGGTGTCATTACCCCACCTGGCAATCTTTCTACTGTCCTCAATGCGACCAATGCCA
CTGCCTTCGTCGCCTTCGCCCAGCAAGTGAACACGACCAATTCCGACGGAAGTAACACCTCGGCGGTCAACTCGC
TGGAGCAGGAAAATGGGTTCACCCTTTTCGTTCCCGACAATGACGCGTTCCAGGCGGCTCAGCAGACAATTGGTG
GTTTCCAGAACAACCAGACCGCTCTAAAGGCTCTTCTGGGCAATCACGTATGACTTTGTTCGACACTGGCACGTC
AGTTTACAGGCTAACGACTTGATAGATCATCAACGGCACTACTCTTTACACCCCTGATTTCCAAAACGCCACCGC
GTCAGGAAGTGGTGCTAATTACATCACGGCTGCTGGCGAGAACCTATCCGTTTCGTCCAACTCCTCCGGTATATT
CCTTCAGAATGAAAACGGTAGTGTTGCCCAGATCACTCGGCCTGATGTTCTCGTCTCAAATGGCGTTTTCCACGT
TATCGACAACGTCCTCGTGGAGACCGATTCCAATCCCGAAGCAGCCTCCTCTGCGTAAGTTTCCGTGACACTCTC
TTAATTCTTTATTAACCTCAATGATTTAGTGTGATGTCCGCCTCGTCTGCTGCAACCGCTCAGAGTTCGACAGAC
ACTCTTCCCATTGGCGGTGGCGCAACCCTCACTTCTGCGGGAGCTACTTCTACTCCTGCTCTTCTTCGGTTCCAT
CGCGCTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail