Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|032680
Gene name
Locationscaffold_12:1292234..1293400
Strand+
Gene length (bp)1166
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 1.1E-54 19 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 3 222 3.0E-31
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 2 243 6.0E-29
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 2 246 2.0E-27
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 16 241 2.0E-21
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 16 241 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 3 222 3.0E-31
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 2 243 6.0E-29
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 2 246 2.0E-27
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 16 241 2.0E-21
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 16 241 2.0E-21
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 61 241 3.0E-21
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 16 241 4.0E-21
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 16 241 4.0E-21
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 17 241 7.0E-20
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 1 241 9.0E-20
sp|Q96WQ9|EGLD_ASPKW Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) GN=eglD PE=3 SV=1 41 241 4.0E-19
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 18 241 5.0E-19
sp|A2R5N0|EGLD_ASPNC Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglD PE=3 SV=1 46 241 6.0E-18
sp|A1C4H2|EGLD_ASPCL Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglD PE=3 SV=1 46 241 2.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|032680
MRLSTLAVPLLTAAYASAHGYVSQLSIGDTLYQGDRTGQPTDNSVIRDVSSQDPIKGADNPDLNCGNGSPRPAGL
NADAKPGDTMSFLWVSADGGNWPHEIGPLITYMASCGDEDCNEFDSTKAKWFKIDQQGQVSDGSNTWVQKETQQR
QPAKVTLPNNIAPGNYLVRHEIIALHLGNSMGGAEFYASCSQLKVSGSGTGKPSSDELVSFPGAYRDDDPGIFTP
KVFDPGFHYDFPGPKIAAFVAEGGGNSDSGSSSGSDDPSPNPNPTSTSNGPTQTNAPDNESTTKCNLKKSSKSSS
NARRSLNVNSRRNSLTDDLVTAGSSLNVKFYPKHISRVMRKTVFGGKH*
Coding >Agabi119p4|032680
ATGAGGCTTTCAACGCTTGCTGTACCTCTGTTGACTGCTGCCTACGCCTCCGCTCATGGATACGTTTCTCAACTC
AGTATCGGTGACACTCTGTACCAGGGCGACAGAACAGGTCAACCTACAGACAACAGTGTCATTCGAGATGTATCA
AGCCAAGATCCTATCAAAGGCGCCGACAATCCGGACCTTAATTGTGGAAATGGCTCCCCCAGACCTGCTGGTCTT
AACGCCGATGCGAAACCTGGGGATACTATGTCATTCTTGTGGGTTTCTGCCGATGGCGGGAATTGGCCTCATGAG
ATTGGACCTTTGATAACGTATATGGCTTCTTGCGGCGATGAGGATTGCAATGAATTCGATTCCACGAAAGCCAAG
TGGTTCAAAATCGACCAACAGGGTCAGGTATCTGATGGTAGTAATACATGGGTGCAAAAAGAAACTCAACAACGT
CAACCCGCCAAAGTAACCCTTCCAAACAACATTGCACCAGGCAATTACCTCGTTCGTCACGAAATCATCGCTCTT
CATCTCGGCAATAGCATGGGCGGAGCCGAATTCTATGCGTCCTGCTCTCAACTCAAAGTCAGCGGTAGTGGAACC
GGTAAACCTAGTTCAGATGAACTTGTCAGTTTCCCGGGTGCCTACCGAGATGACGATCCTGGAATCTTCACTCCC
AAAGTCTTTGACCCAGGATTCCATTACGATTTCCCTGGTCCCAAGATCGCTGCCTTCGTCGCCGAGGGAGGTGGT
AATTCAGATTCGGGTTCCAGTTCCGGATCAGATGATCCATCGCCAAATCCAAATCCAACATCAACATCGAATGGC
CCTACTCAGACAAATGCCCCAGATAATGAATCCACGACGAAATGCAATCTAAAAAAATCTTCCAAATCGTCAAGT
AATGCTAGAAGATCACTTAACGTCAACTCACGTCGTAATAGCTTGACGGATGATTTAGTGACGGCCGGTTCGTCG
TTGAATGTCAAGTTTTACCCGAAACATATCAGTCGGGTTATGAGGAAAACTGTTTTCGGTGGAAAGCATTAG
Transcript >Agabi119p4|032680
ATGAGGCTTTCAACGCTTGCTGTACCTCTGTTGACTGCTGCCTACGCCTCCGCTCATGGATACGTTTCTCAACTC
AGTATCGGTGACACTCTGTACCAGGGCGACAGAACAGGTCAACCTACAGACAACAGTGTCATTCGAGATGTATCA
AGCCAAGATCCTATCAAAGGCGCCGACAATCCGGACCTTAATTGTGGAAATGGCTCCCCCAGACCTGCTGGTCTT
AACGCCGATGCGAAACCTGGGGATACTATGTCATTCTTGTGGGTTTCTGCCGATGGCGGGAATTGGCCTCATGAG
ATTGGACCTTTGATAACGTATATGGCTTCTTGCGGCGATGAGGATTGCAATGAATTCGATTCCACGAAAGCCAAG
TGGTTCAAAATCGACCAACAGGGTCAGGTATCTGATGGTAGTAATACATGGGTGCAAAAAGAAACTCAACAACGT
CAACCCGCCAAAGTAACCCTTCCAAACAACATTGCACCAGGCAATTACCTCGTTCGTCACGAAATCATCGCTCTT
CATCTCGGCAATAGCATGGGCGGAGCCGAATTCTATGCGTCCTGCTCTCAACTCAAAGTCAGCGGTAGTGGAACC
GGTAAACCTAGTTCAGATGAACTTGTCAGTTTCCCGGGTGCCTACCGAGATGACGATCCTGGAATCTTCACTCCC
AAAGTCTTTGACCCAGGATTCCATTACGATTTCCCTGGTCCCAAGATCGCTGCCTTCGTCGCCGAGGGAGGTGGT
AATTCAGATTCGGGTTCCAGTTCCGGATCAGATGATCCATCGCCAAATCCAAATCCAACATCAACATCGAATGGC
CCTACTCAGACAAATGCCCCAGATAATGAATCCACGACGAAATGCAATCTAAAAAAATCTTCCAAATCGTCAAGT
AATGCTAGAAGATCACTTAACGTCAACTCACGTCGTAATAGCTTGACGGATGATTTAGTGACGGCCGGTTCGTCG
TTGAATGTCAAGTTTTACCCGAAACATATCAGTCGGGTTATGAGGAAAACTGTTTTCGGTGGAAAGCATTAG
Gene >Agabi119p4|032680
ATGAGGCTTTCAACGCTTGCTGTACCTCTGTTGACTGCTGCCTACGCCTCCGCTCATGGATACGTTTCTCAACTC
AGTATCGGTGACACTCTGTACCAGGGCGACAGAACAGGTCAACCTACAGACAACAGTGTCATTCGAGATGTATCA
AGCCAAGATCCTATCAAAGGCGCCGACAATCCGGACCTTAATTGTGGAAATGGCTCCCCCAGACCTGCTGGTCTT
AACGCCGATGCGAAACCTGGGGATACTATGTCATTCTTGTGGGTTTCTGCCGATGGCGGGAATGTGAGTCTACCT
TCCCTCAACCTTCCTTTACATGATGTTCAAGTGTTTTTCCCCAACAGTGGCCTCATGAGATTGGACCTTTGATAA
CGTATATGGCTTCTTGCGGCGATGAGGATTGCAATGAATTCGATTCCACGAAAGCCAAGTGGTTCAAAATCGACC
AACAGGGTCAGGTATCTGATGGTAGTAATACATGGGTGCAAAAAGAAACTCGTATGCTTCTTCTCGTCCTTTCAT
CTCCTCGATTTCAATTCTAATGAAGTTTTTTCTAAGAACAACGTCAACCCGCCAAAGTAACCCTTCCAAACAACA
TTGCACCAGGCAATTACCTCGTTCGTCACGAAATCATCGCTCTTCATCTCGGCAATAGCATGGGCGGAGCCGAAT
TCTATGCGTCCTGCTCTCAACTCAAAGTCAGCGGTAGTGGAACCGGTAAACCTAGTTCAGATGAACTTGTCAGTT
TCCCGGGTGCCTACCGAGATGACGATCCTGGAATCTTCACTCCCAAAGTCTTTGACCCAGGATTCCATTACGATT
TCCCTGGTCCCAAGATCGCTGCCTTCGTCGCCGAGGGAGGTGGTAATTCAGATTCGGGTTCCAGTTCCGGATCAG
ATGATCCATCGCCAAATCCAAATCCAACATCAACATCGAATGGCCCTACTCAGACAAATGCCCCAGATAATGAAT
CCACGACGAAATGCAATCTAAAAAAATCTTCCAAATCGTCAAGTAATGCTAGAAGATCACTTAACGTCAACTCAC
GTCGTAATAGCTTGACGGATGATTTAGTGACGGCCGGTTCGTCGTTGAATGTCAAGTTTTACCCGAAACATATCA
GTCGGGTTATGAGGAAAACTGTTTTCGGTGGAAAGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail