Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|032630
Gene name
Locationscaffold_12:1275875..1278263
Strand+
Gene length (bp)2388
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08144 CPL CPL (NUC119) domain 4.9E-31 439 573

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU76|PUF6_SCHPO Pumilio homology domain family member 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf6 PE=1 SV=1 93 622 1.0E-64
sp|X1WGX5|PUM3_DANRE Pumilio homolog 3 OS=Danio rerio GN=pum3 PE=2 SV=2 103 537 8.0E-55
sp|Q04373|PUF6_YEAST Pumilio homology domain family member 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF6 PE=1 SV=1 96 576 2.0E-51
sp|Q562C7|PUM3_RAT Pumilio homolog 3 OS=Rattus norvegicus GN=Pum3 PE=2 SV=1 116 549 7.0E-48
sp|Q15397|PUM3_HUMAN Pumilio homolog 3 OS=Homo sapiens GN=PUM3 PE=1 SV=3 111 550 8.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU76|PUF6_SCHPO Pumilio homology domain family member 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf6 PE=1 SV=1 93 622 1.0E-64
sp|X1WGX5|PUM3_DANRE Pumilio homolog 3 OS=Danio rerio GN=pum3 PE=2 SV=2 103 537 8.0E-55
sp|Q04373|PUF6_YEAST Pumilio homology domain family member 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF6 PE=1 SV=1 96 576 2.0E-51
sp|Q562C7|PUM3_RAT Pumilio homolog 3 OS=Rattus norvegicus GN=Pum3 PE=2 SV=1 116 549 7.0E-48
sp|Q15397|PUM3_HUMAN Pumilio homolog 3 OS=Homo sapiens GN=PUM3 PE=1 SV=3 111 550 8.0E-45
sp|Q8BKS9|PUM3_MOUSE Pumilio homolog 3 OS=Mus musculus GN=Pum3 PE=1 SV=2 116 550 8.0E-45
sp|Q9LRZ3|PUM24_ARATH Pumilio homolog 24 OS=Arabidopsis thaliana GN=APUM24 PE=2 SV=1 98 464 1.0E-38
sp|Q09622|PUF12_CAEEL Pumilio domain-containing protein 12 OS=Caenorhabditis elegans GN=puf-12 PE=3 SV=1 91 518 5.0E-30
sp|O61345|PENG_DROME Protein penguin OS=Drosophila melanogaster GN=peng PE=2 SV=1 152 552 1.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|032630
MVAQKNNKKRSAPTKLESKAKRRNDETEILEKTVEKKRSRPVTHTFPIVEESDSEDVGEDEDADIAMEDEPLIDQ
DAMEVEGETNVPKDPNAARESHKAQKVLHEQRKAAKPHSTLLTDAKRVWSLARQQNIPSAQRQKHIADLMDVIRG
KVKEIVLKHDASRIVQTIIKYGKQKERDEIALELKGKYRDLVQSRYSKFLVSKLIRLCPTHRPWILQEFQSNILR
LLLHREASSVLADSFELYANAYERTFLLRDFYGKEAVLFNVTHGSAEDKERDKKGLSGILEGADEGRRNRTLAAV
KENLLLVFNNSDKGAVTHAVVHRILWEYLCAISMIDDEAEQEKSRRDIFDSCQESLAEMVHTKDGSRVVREFLVR
GSAKDRKQILKVLKPHIERMCLDDEAQLVLFTALDVIDDTKLLSKSLISEITTPANNIYEKPQGLRALVYLLAPR
TRRHFMPAQIASLEETDAVRARTSKKDPEARADEIRKFASEALLNWITENGAKVAREPRGSLIVTEIMLYAEGDK
TSATKTLVEALAVPYPSLDASTLHPVDLSWTSRMYKTLLQGGHFNRKTQSVDTTEHWNASQFASSIIDTAPRDIV
IAMCTEGERNGTFLLVTLCEALLKQEDEKEVEREKLKGYFGENEWERVRSGVGKGKDLLLEKLALL*
Coding >Agabi119p4|032630
ATGGTTGCGCAAAAAAATAACAAAAAACGGTCGGCACCGACGAAACTTGAGTCTAAGGCGAAAAGGCGTAACGAC
GAGACAGAAATACTCGAAAAAACTGTGGAAAAGAAAAGGAGTCGACCTGTGACACATACTTTTCCTATCGTCGAA
GAGTCGGACTCGGAGGATGTTGGCGAAGACGAGGATGCAGATATCGCCATGGAAGATGAGCCACTAATTGACCAG
GATGCGATGGAAGTAGAAGGCGAAACAAACGTGCCGAAAGACCCAAATGCCGCCAGAGAATCCCACAAAGCGCAA
AAAGTGTTGCATGAACAGCGAAAGGCGGCGAAACCCCATTCAACCTTGCTCACTGATGCCAAACGAGTATGGTCG
CTCGCCCGGCAACAGAATATACCCAGCGCGCAGCGTCAGAAGCACATCGCGGATCTCATGGACGTCATACGCGGG
AAAGTAAAAGAAATTGTCCTCAAGCATGATGCTAGTAGAATCGTTCAAACGATCATCAAGTACGGAAAACAAAAA
GAAAGGGATGAAATCGCCCTCGAGCTCAAGGGGAAATATAGAGACCTTGTTCAGAGCCGGTATTCAAAGTTCCTT
GTATCCAAACTCATTCGCCTCTGCCCTACACATCGACCTTGGATCCTACAAGAATTCCAATCCAATATCCTTCGG
CTCCTCCTTCATCGTGAAGCATCTTCTGTCCTCGCTGACTCTTTCGAGCTCTATGCAAATGCTTATGAACGAACA
TTTCTCTTACGGGACTTTTACGGTAAAGAAGCTGTGCTCTTTAATGTCACACACGGAAGTGCTGAGGACAAGGAG
CGGGACAAGAAGGGTCTATCTGGAATTCTGGAAGGAGCAGACGAGGGTAGACGGAATCGGACGCTGGCTGCAGTC
AAAGAAAACCTATTACTCGTGTTTAACAACTCGGATAAGGGAGCTGTGACTCATGCTGTTGTTCATCGTATCCTC
TGGGAATACCTTTGTGCGATTAGCATGATTGACGACGAGGCAGAGCAAGAAAAATCAAGGAGAGATATCTTTGAC
AGTTGTCAGGAATCATTAGCGGAGATGGTGCACACGAAAGATGGGAGTCGCGTTGTACGCGAATTTCTGGTTCGG
GGCTCAGCGAAGGACCGAAAACAAATACTCAAGGTCCTCAAACCTCATATCGAACGCATGTGTCTCGATGACGAA
GCACAGCTTGTTCTTTTCACTGCTCTCGATGTCATTGACGACACGAAGCTCCTCTCAAAATCTCTAATATCCGAA
ATCACCACACCCGCTAACAACATCTATGAAAAACCTCAAGGCCTCCGAGCCCTTGTATATCTCCTTGCACCGCGC
ACTCGAAGACACTTTATGCCTGCACAGATCGCCTCCTTGGAAGAGACAGACGCTGTTCGTGCGCGAACGAGTAAA
AAAGATCCGGAAGCACGTGCAGACGAGATTCGCAAGTTTGCTAGTGAAGCTTTATTAAATTGGATAACTGAGAAT
GGAGCAAAGGTTGCAAGAGAGCCGAGAGGAAGTTTGATTGTGACTGAAATTATGCTTTATGCTGAAGGAGATAAA
ACAAGTGCGACGAAGACCTTGGTAGAAGCTCTAGCCGTGCCTTATCCATCTCTGGACGCGTCGACTTTGCATCCG
GTTGATCTTTCATGGACATCACGGATGTACAAAACTTTACTGCAAGGTGGACACTTCAATAGAAAAACCCAGTCA
GTCGATACTACCGAACATTGGAATGCTTCGCAGTTTGCAAGTAGTATCATTGATACTGCACCTCGTGATATCGTA
ATCGCTATGTGCACCGAAGGAGAAAGGAATGGGACTTTTCTTCTTGTGACGTTATGTGAGGCATTATTGAAACAA
GAAGATGAGAAAGAAGTGGAGAGGGAGAAGTTGAAAGGCTATTTTGGGGAAAACGAGTGGGAGAGGGTAAGGAGT
GGAGTTGGTAAGGGTAAGGATCTCTTGTTGGAGAAGTTGGCGTTGTTGTGA
Transcript >Agabi119p4|032630
ATGGTTGCGCAAAAAAATAACAAAAAACGGTCGGCACCGACGAAACTTGAGTCTAAGGCGAAAAGGCGTAACGAC
GAGACAGAAATACTCGAAAAAACTGTGGAAAAGAAAAGGAGTCGACCTGTGACACATACTTTTCCTATCGTCGAA
GAGTCGGACTCGGAGGATGTTGGCGAAGACGAGGATGCAGATATCGCCATGGAAGATGAGCCACTAATTGACCAG
GATGCGATGGAAGTAGAAGGCGAAACAAACGTGCCGAAAGACCCAAATGCCGCCAGAGAATCCCACAAAGCGCAA
AAAGTGTTGCATGAACAGCGAAAGGCGGCGAAACCCCATTCAACCTTGCTCACTGATGCCAAACGAGTATGGTCG
CTCGCCCGGCAACAGAATATACCCAGCGCGCAGCGTCAGAAGCACATCGCGGATCTCATGGACGTCATACGCGGG
AAAGTAAAAGAAATTGTCCTCAAGCATGATGCTAGTAGAATCGTTCAAACGATCATCAAGTACGGAAAACAAAAA
GAAAGGGATGAAATCGCCCTCGAGCTCAAGGGGAAATATAGAGACCTTGTTCAGAGCCGGTATTCAAAGTTCCTT
GTATCCAAACTCATTCGCCTCTGCCCTACACATCGACCTTGGATCCTACAAGAATTCCAATCCAATATCCTTCGG
CTCCTCCTTCATCGTGAAGCATCTTCTGTCCTCGCTGACTCTTTCGAGCTCTATGCAAATGCTTATGAACGAACA
TTTCTCTTACGGGACTTTTACGGTAAAGAAGCTGTGCTCTTTAATGTCACACACGGAAGTGCTGAGGACAAGGAG
CGGGACAAGAAGGGTCTATCTGGAATTCTGGAAGGAGCAGACGAGGGTAGACGGAATCGGACGCTGGCTGCAGTC
AAAGAAAACCTATTACTCGTGTTTAACAACTCGGATAAGGGAGCTGTGACTCATGCTGTTGTTCATCGTATCCTC
TGGGAATACCTTTGTGCGATTAGCATGATTGACGACGAGGCAGAGCAAGAAAAATCAAGGAGAGATATCTTTGAC
AGTTGTCAGGAATCATTAGCGGAGATGGTGCACACGAAAGATGGGAGTCGCGTTGTACGCGAATTTCTGGTTCGG
GGCTCAGCGAAGGACCGAAAACAAATACTCAAGGTCCTCAAACCTCATATCGAACGCATGTGTCTCGATGACGAA
GCACAGCTTGTTCTTTTCACTGCTCTCGATGTCATTGACGACACGAAGCTCCTCTCAAAATCTCTAATATCCGAA
ATCACCACACCCGCTAACAACATCTATGAAAAACCTCAAGGCCTCCGAGCCCTTGTATATCTCCTTGCACCGCGC
ACTCGAAGACACTTTATGCCTGCACAGATCGCCTCCTTGGAAGAGACAGACGCTGTTCGTGCGCGAACGAGTAAA
AAAGATCCGGAAGCACGTGCAGACGAGATTCGCAAGTTTGCTAGTGAAGCTTTATTAAATTGGATAACTGAGAAT
GGAGCAAAGGTTGCAAGAGAGCCGAGAGGAAGTTTGATTGTGACTGAAATTATGCTTTATGCTGAAGGAGATAAA
ACAAGTGCGACGAAGACCTTGGTAGAAGCTCTAGCCGTGCCTTATCCATCTCTGGACGCGTCGACTTTGCATCCG
GTTGATCTTTCATGGACATCACGGATGTACAAAACTTTACTGCAAGGTGGACACTTCAATAGAAAAACCCAGTCA
GTCGATACTACCGAACATTGGAATGCTTCGCAGTTTGCAAGTAGTATCATTGATACTGCACCTCGTGATATCGTA
ATCGCTATGTGCACCGAAGGAGAAAGGAATGGGACTTTTCTTCTTGTGACGTTATGTGAGGCATTATTGAAACAA
GAAGATGAGAAAGAAGTGGAGAGGGAGAAGTTGAAAGGCTATTTTGGGGAAAACGAGTGGGAGAGGGTAAGGAGT
GGAGTTGGTAAGGGTAAGGATCTCTTGTTGGAGAAGTTGGCGTTGTTGTGA
Gene >Agabi119p4|032630
ATGGTTGCGCAAAAAAATAACAAAAAACGGTCGGCACCGACGAAACTTGAGTCTAAGGCGAAAAGGCGTAACGAC
GAGACAGAAATACTCGAAAAAACTGTGGAAAAGAAAAGGAGTCGACCTGTGACACATACTTTTCCTATCGTCGAA
GAGTCGGACTCGGAGGATGTTGGCGAAGACGAGGATGCAGATATCGCCATGGAAGATGAGCCACTAATTGACCAG
GATGCGATGGAAGTAGAAGGCGAAACAAACGTGCCGAAAGACCCAAATGGTGTGTTGCATCCATAATTTCACGGA
ATATCCAATAATCAATACACAAAGCCGCCAGAGAATCCCACAAAGCGCAAAAAGTGTTGCATGAACAGCGAAAGG
CGGCGAAACCCCATTCAACCTTGCTCACTGATGCCAAACGAGTATGGTCGCTCGCCCGGCAACAGAATATACCCA
GCGCGCAGCGTCAGAAGCACATCGCGGATCTCATGGACGTCATACGCGGGAAAGTAAAAGAAATTGTCCTCAAGC
ATGATGCTAGTAGAATCGTTCAAACGATCATCAAGTACGGAAAACAAAAAGAAAGGGATGAAATCGCCCTCGAGC
TCAAGGGGAAATATAGAGACCTTGTTCAGAGCCGGTATTCAAAGGTGTGTCTAGCGTCCCACCAACAATCAAATT
CATAGCTGAAAAAAAATCAGTTCCTTGTATCCAAACTCATTCGCCTCTGCCCTACACATCGACCTTGGATCCTAC
AAGAATTCCAATCCAATATCCTTCGGCTCCTCCTTCATCGTGAAGCATCTTCTGTCCTCGCTGACTCTTTCGAGC
TCTATGCAAATGCTTATGAACGAACATTTCTCTTACGGGACTTTTACGGTAAAGAAGCTGTGCTCTTTAATGTCA
CACACGGAAGTGCTGAGGACAAGGAGCGGGACAAGAAGGGTCTATCTGGAATTCTGGAAGGAGCAGACGAGGGTA
GACGGAATCGGACGCTGGCTGCAGTCAAAGAAAACCTATTACTCGTGTATGTCCAGATGACATGATTTTCTGCCC
CCCCGAAACTTAACGGAGTTTTAGGTTTAACAACTCGGATAAGGGAGCTGTGACTCATGCTGTTGTTCATCGTAT
CCTCTGGGAATACCTTTGTGCGATTAGCATGATTGACGACGAGGCAGAGCAAGAAAAATCAAGGAGAGATATCTT
TGACAGGTATTGTACGATCGCTGATTTTTCACGTAACGAAACTCATAGTATTAGTTGTCAGGAATCATTAGCGGA
GATGGTGCACACGAAAGATGGGAGTCGCGTTGTACGCGAATTTCTGGTTCGGGGCTCAGCGAAGGTTCGTCACTA
GCCCTTCTCACCGTGACGCATGATATAGATATTCTTGGTCTTACAGGACCGAAAACAAATACTCAAGGTCCTCAA
ACCTCATATCGAACGCATGTGTCTCGATGACGAAGCACAGCTTGTTCTTTTCACTGCTCTCGATGTCATTGAGTA
CGTCAAAAACATAATCCATCAAGTTCTGCTTTCGTTCAGCCTGATCTTACTATGTCTATCTTAGCGACACGAAGC
TCCTCTCAAAATCTCTAATATCCGAAATCACCACACCCGCTAACAACATCTATGAAAAACCTCAAGGCCTCCGAG
CCCTTGTATATCTCCTTGCACCGCGCACTCGAAGACACTTTATGCCTGCACAGATCGCCTCCTTGGAAGAGACAG
ACGCTGTTCGTGCGCGAACGAGTAAAAAAGATCCGGAAGCACGTGCAGACGAGATTCGCAAGTTTGCTAGTGAAG
CTTTATTAAATTGGATAACTGAGAATGGAGCAAAGGTTGCAAGAGAGCCGAGAGGAAGTTTGATTGTGACTGAAA
TTATGCTTTATGCTGAAGGAGGTCAGGCGTTACTGTTTATTCATTATCCTTTACAAGGCTGATCGCGTACTCTGG
GATGCAGATAAAACAAGTGCGACGAAGACCTTGGTAGAAGCTCTAGCCGTGCCTTATCCATCTCTGGACGCGTCG
ACTTTGCATCCGGTTGATCTTTCATGGACATCACGGATGTACAAAACTTTACTGCAAGGTGGACACTTCAATAGA
AAAACCCAGTCAGTCGATACTACCGAACATTGGAATGCTTCGCAGTTTGCAAGTAGTATCATTGATACTGCACCT
CGTGATATCGTAATCGCTATGTGCACCGAAGGAGAAAGGAATGGGACTTTTCTTCTTGTGACGTTATGTGAGGCA
TTATTGAAACAAGAAGATGAGAAAGAAGTGGAGAGGGAGAAGTTGAAAGGCTATTTTGGGGAAAACGAGTGGGAG
AGGGTAAGGAGTGGAGTTGGTAAGGGTAAGGATCTCTTGTTGGAGAAGTTGGCGTTGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail