Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|032040
Gene name
Locationscaffold_12:1123806..1125900
Strand+
Gene length (bp)2094
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 1.2E-16 483 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 28 609 1.0E-82
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 487 601 2.0E-12
sp|G3V9D0|PGLT1_RAT Protein O-glucosyltransferase 1 OS=Rattus norvegicus GN=Poglut1 PE=3 SV=1 487 599 3.0E-12
sp|Q5E9Q1|PGLT1_BOVIN Protein O-glucosyltransferase 1 OS=Bos taurus GN=POGLUT1 PE=2 SV=1 487 599 2.0E-11
sp|Q8BYB9|PGLT1_MOUSE Protein O-glucosyltransferase 1 OS=Mus musculus GN=Poglut1 PE=1 SV=2 487 599 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 28 609 1.0E-82
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 487 601 2.0E-12
sp|G3V9D0|PGLT1_RAT Protein O-glucosyltransferase 1 OS=Rattus norvegicus GN=Poglut1 PE=3 SV=1 487 599 3.0E-12
sp|Q5E9Q1|PGLT1_BOVIN Protein O-glucosyltransferase 1 OS=Bos taurus GN=POGLUT1 PE=2 SV=1 487 599 2.0E-11
sp|Q8BYB9|PGLT1_MOUSE Protein O-glucosyltransferase 1 OS=Mus musculus GN=Poglut1 PE=1 SV=2 487 599 3.0E-11
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 487 601 3.0E-11
sp|B0X1Q4|RUMI_CULQU O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus GN=CPIJ013394 PE=3 SV=1 479 601 3.0E-10
sp|Q8NBL1|PGLT1_HUMAN Protein O-glucosyltransferase 1 OS=Homo sapiens GN=POGLUT1 PE=1 SV=1 487 599 3.0E-10
sp|Q7ZVE6|KDEL1_DANRE KDEL motif-containing protein 1 OS=Danio rerio GN=kdelc1 PE=2 SV=1 487 597 6.0E-10
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 487 599 9.0E-09
sp|Q16QY8|RUMI_AEDAE O-glucosyltransferase rumi homolog OS=Aedes aegypti GN=AAEL011121 PE=3 SV=1 479 598 7.0E-08
sp|A0NDG6|RUMI_ANOGA O-glucosyltransferase rumi homolog OS=Anopheles gambiae GN=AGAP004267 PE=3 SV=1 482 598 2.0E-07
sp|Q7Z4H8|KDEL2_HUMAN KDEL motif-containing protein 2 OS=Homo sapiens GN=KDELC2 PE=1 SV=2 487 600 7.0E-07
sp|Q8T045|RUMI_DROME O-glucosyltransferase rumi OS=Drosophila melanogaster GN=rumi PE=1 SV=1 487 599 2.0E-06
sp|Q566E5|KDEL2_RAT KDEL motif-containing protein 2 OS=Rattus norvegicus GN=Kdelc2 PE=2 SV=1 487 595 4.0E-06
sp|P39907|LPSA_DICNO O-glucosyltransferase LpsA OS=Dichelobacter nodosus GN=lpsA PE=3 SV=1 476 581 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|032040
MSARRLCRRSTSIFLAGIVISLVLFYSYREDGQRTPNFFFSTAFTTVVTTVTLYKTTTAAAVPTTSTDARTKLEK
HFYRGDGLLEVNYGGAHPIFELVRRAERDWEDKLKRASKTLVDAVKEYRRRYNRDPPKGFDIWWKYVTEHNVQLP
DEYDQIFHDLEPFWGLEPSDLFKTQAELETRIDSYTIGKQDGSDVDVLTYAFTEGRYDQLIAGSKKIIALLSEIQ
HLLPDFRMTISPHDGPNFLSDWEIKRATLEAAAAKTYLERETLPKVTSSGWITACPPRSLARRIPINLEIPFAPS
SKKTFIYNHRQTMDPCIHPSHFYRHGQFLSHNNGPRPQSTMIPEFSYCATTLHHNIRIPVPYGWVEDVTPRDQDP
DFDDKVDDRLLWRGSNTGIFHASSTRWKDSHRDFLVRTTNDFDGSLDMLMPTNKDDRSVGNPRKLKKSVINPTFF
DIAFSKEPISCSKDVCPVLEEIYPWRPYMKQDEAGTYRYVLDVDGNGWSGRFKRLITSNSLIFKSTIYPEWYTDR
ISAWVHYVPVQVDLSDLHDCLVFFRGDGNGEGSHDDLGKKIAKAGREWSLKFWRHEDINAYFFRLILEYARLMSS
DRAAMSYTSNF*
Coding >Agabi119p4|032040
ATGTCCGCACGCCGACTTTGCAGACGCTCCACAAGCATATTTCTGGCCGGAATCGTTATATCTCTTGTCCTTTTC
TATTCATATCGGGAAGACGGGCAAAGAACGCCTAACTTCTTCTTTTCGACTGCTTTCACGACTGTTGTGACGACT
GTGACGCTATACAAGACTACCACTGCTGCTGCTGTGCCAACAACATCTACTGATGCGCGGACGAAACTTGAGAAG
CATTTTTATCGTGGAGATGGGCTGTTGGAAGTCAATTATGGTGGAGCGCATCCGATATTTGAGTTGGTGAGACGG
GCGGAGAGGGATTGGGAGGATAAGTTGAAGCGTGCTAGTAAGACTCTGGTTGATGCTGTCAAGGAGTATCGGAGA
CGGTATAACCGGGATCCTCCAAAAGGGTTTGACATCTGGTGGAAGTATGTAACGGAACACAACGTTCAACTTCCA
GATGAATATGACCAGATCTTTCATGACCTTGAACCGTTTTGGGGTTTAGAGCCTTCAGACCTCTTCAAGACTCAA
GCGGAACTGGAAACCAGAATCGACTCGTACACTATTGGAAAGCAAGACGGTTCTGATGTTGACGTTCTGACTTAT
GCCTTTACGGAAGGACGGTATGACCAGCTTATTGCGGGGTCGAAGAAGATTATTGCGCTTCTGAGCGAAATTCAA
CATTTGTTGCCGGATTTTCGTATGACGATATCACCTCATGATGGACCGAACTTTTTGTCTGACTGGGAAATTAAG
CGAGCGACGTTGGAAGCTGCAGCAGCTAAAACATATCTTGAAAGAGAAACACTTCCCAAAGTCACTTCATCTGGG
TGGATAACCGCTTGCCCGCCTAGAAGTCTAGCTCGTCGAATACCCATTAACCTTGAAATACCCTTTGCTCCATCA
TCAAAAAAGACCTTCATCTATAATCACCGTCAAACGATGGACCCTTGTATTCATCCCAGCCATTTTTATCGCCAT
GGTCAATTCCTTTCCCATAACAATGGTCCCAGACCTCAGTCTACCATGATACCCGAGTTCTCTTATTGTGCCACC
ACTCTACATCACAATATCCGAATCCCTGTGCCTTATGGATGGGTCGAAGACGTCACACCACGCGATCAGGATCCT
GACTTTGACGATAAAGTGGACGATCGGTTGTTATGGCGGGGAAGTAACACGGGAATTTTTCATGCAAGCTCGACT
CGCTGGAAGGACTCGCATCGCGATTTCTTGGTGCGAACTACCAACGACTTTGATGGGTCACTTGATATGTTAATG
CCCACGAACAAGGACGACAGATCGGTGGGAAATCCTCGAAAGCTGAAAAAATCGGTCATCAACCCTACGTTCTTC
GATATCGCCTTTTCCAAAGAACCAATCAGCTGTTCAAAAGACGTTTGCCCTGTTTTAGAAGAGATATACCCATGG
CGGCCATATATGAAGCAAGACGAAGCAGGAACGTATCGCTATGTGTTAGATGTTGATGGAAATGGCTGGTCAGGT
CGTTTCAAGCGCCTCATCACCTCTAACTCGTTGATATTCAAATCAACTATATACCCAGAATGGTACACTGACAGA
ATTTCTGCCTGGGTTCATTACGTCCCTGTGCAAGTAGACTTGTCAGATTTACATGACTGTCTAGTCTTTTTTCGC
GGTGACGGTAATGGTGAAGGGTCTCACGACGATTTGGGGAAAAAAATTGCAAAAGCTGGTCGGGAATGGAGTTTG
AAGTTCTGGAGACACGAAGATATTAATGCTTATTTCTTTCGGTTGATACTAGAGTATGCTCGTTTAATGAGTTCA
GATAGGGCAGCGATGTCGTATACTTCAAATTTTTAA
Transcript >Agabi119p4|032040
ATGTCCGCACGCCGACTTTGCAGACGCTCCACAAGCATATTTCTGGCCGGAATCGTTATATCTCTTGTCCTTTTC
TATTCATATCGGGAAGACGGGCAAAGAACGCCTAACTTCTTCTTTTCGACTGCTTTCACGACTGTTGTGACGACT
GTGACGCTATACAAGACTACCACTGCTGCTGCTGTGCCAACAACATCTACTGATGCGCGGACGAAACTTGAGAAG
CATTTTTATCGTGGAGATGGGCTGTTGGAAGTCAATTATGGTGGAGCGCATCCGATATTTGAGTTGGTGAGACGG
GCGGAGAGGGATTGGGAGGATAAGTTGAAGCGTGCTAGTAAGACTCTGGTTGATGCTGTCAAGGAGTATCGGAGA
CGGTATAACCGGGATCCTCCAAAAGGGTTTGACATCTGGTGGAAGTATGTAACGGAACACAACGTTCAACTTCCA
GATGAATATGACCAGATCTTTCATGACCTTGAACCGTTTTGGGGTTTAGAGCCTTCAGACCTCTTCAAGACTCAA
GCGGAACTGGAAACCAGAATCGACTCGTACACTATTGGAAAGCAAGACGGTTCTGATGTTGACGTTCTGACTTAT
GCCTTTACGGAAGGACGGTATGACCAGCTTATTGCGGGGTCGAAGAAGATTATTGCGCTTCTGAGCGAAATTCAA
CATTTGTTGCCGGATTTTCGTATGACGATATCACCTCATGATGGACCGAACTTTTTGTCTGACTGGGAAATTAAG
CGAGCGACGTTGGAAGCTGCAGCAGCTAAAACATATCTTGAAAGAGAAACACTTCCCAAAGTCACTTCATCTGGG
TGGATAACCGCTTGCCCGCCTAGAAGTCTAGCTCGTCGAATACCCATTAACCTTGAAATACCCTTTGCTCCATCA
TCAAAAAAGACCTTCATCTATAATCACCGTCAAACGATGGACCCTTGTATTCATCCCAGCCATTTTTATCGCCAT
GGTCAATTCCTTTCCCATAACAATGGTCCCAGACCTCAGTCTACCATGATACCCGAGTTCTCTTATTGTGCCACC
ACTCTACATCACAATATCCGAATCCCTGTGCCTTATGGATGGGTCGAAGACGTCACACCACGCGATCAGGATCCT
GACTTTGACGATAAAGTGGACGATCGGTTGTTATGGCGGGGAAGTAACACGGGAATTTTTCATGCAAGCTCGACT
CGCTGGAAGGACTCGCATCGCGATTTCTTGGTGCGAACTACCAACGACTTTGATGGGTCACTTGATATGTTAATG
CCCACGAACAAGGACGACAGATCGGTGGGAAATCCTCGAAAGCTGAAAAAATCGGTCATCAACCCTACGTTCTTC
GATATCGCCTTTTCCAAAGAACCAATCAGCTGTTCAAAAGACGTTTGCCCTGTTTTAGAAGAGATATACCCATGG
CGGCCATATATGAAGCAAGACGAAGCAGGAACGTATCGCTATGTGTTAGATGTTGATGGAAATGGCTGGTCAGGT
CGTTTCAAGCGCCTCATCACCTCTAACTCGTTGATATTCAAATCAACTATATACCCAGAATGGTACACTGACAGA
ATTTCTGCCTGGGTTCATTACGTCCCTGTGCAAGTAGACTTGTCAGATTTACATGACTGTCTAGTCTTTTTTCGC
GGTGACGGTAATGGTGAAGGGTCTCACGACGATTTGGGGAAAAAAATTGCAAAAGCTGGTCGGGAATGGAGTTTG
AAGTTCTGGAGACACGAAGATATTAATGCTTATTTCTTTCGGTTGATACTAGAGTATGCTCGTTTAATGAGTTCA
GATAGGGCAGCGATGTCGTATACTTCAAATTTTTAA
Gene >Agabi119p4|032040
ATGTCCGCACGCCGACTTTGCAGACGCTCCACAAGCATATTTCTGGCCGGAATCGTTATATCTCTTGTCCTTTTC
TATTCATATCGGGAAGACGGGCAAAGAACGCCTAACTTCTTCTTTTCGACTGCTTTCACGACTGTTGTGACGACT
GTGACGCTATACAAGACTACCACTGCTGCTGCTGTGCCAACAACATCTACTGATGCGCGGACGAAACTTGAGAAG
CATTTTTATCGTGGAGATGGGCTGTTGGAAGTCAATTATGGTGGAGCGCATCCGATATTTGAGTTGGTGAGACGG
GCGGAGAGGGATTGGGAGGATAAGTTGAAGCGTGCTAGTAAGACTCTGGTTGATGCTGTCAAGGAGTATCGGAGA
CGGTATAACCGGGATCCTCCAAAAGGGTTTGACATCTGGTGCGTTCAAGTGGATATACTACTTTTTTCTTTCTTT
CTAATTTGTGCACCAGGTGGAAGTATGTAACGGAACACAACGTTCAACTTCCAGATGAATATGACCAGATCTTTC
ATGACCTTGAACCGTTTTGGGGTTTAGAGCCTTCAGACCTCTTCAAGACTCAAGCGGAACTGGAAACCAGAATCG
ACTCGTACACTATTGGAAAGCAAGACGGTTCTGATGTTGACGTTCTGACTTATGCCTTTACGGAAGGACGGTATG
ACCAGCTTATTGCGGGGTCGAAGAAGATTATTGCGCTTCTGAGCGAAATTCAACATTTGTTGCCGGATTTTCGTA
TGACGATATCACCTCATGATGGACCGAACTTTTTGTCTGACTGGGAAATTAAGCGAGCGACGTTGGAAGCTGCAG
CAGCTAAAACATGTGAGTCCTTTCCTTCATAACAGAATCTTACCATTTTATGATTATTTCCAGATCTTGAAAGAG
AAACACTTCCCAAAGTCACTTCATCTGGGTGGATAACCGCTTGCCCGCCTAGAAGTCTAGCTCGTCGAATACCCA
TTAACCTTGAAATACCCTTTGCTCCATCATCAAAAAAGACCTTCATCTATAATCACCGTCAAACGATGGACCCTT
GTATTCATCCCAGCCATTTTTATCGCCATGGTCAATTCCTTTCCCATAACAATGGTCCCAGACCTCAGTCTACCA
TGATACCCGAGTTCTCTTATTGTGCCACCACTCTACATCACAATATCCGAATCCCTGTGCCTTATGGATGGGTCG
AAGACGTCACACCACGCGATCAGGATCCTGACTTTGACGATAAAGTGGACGATCGGTTGTTATGGCGGGGAAGTA
ACACGGGAATTTTTCATGCAAGCTCGACTCGCTGGAAGGACTCGCATCGCGATTTCTTGGTGCGAACTACCAACG
ACTTTGATGGGTCACTTGATATGTTAATGCCCACGAACAAGGACGACAGATCGGTGGGAAATCCTCGAAAGCTGA
AAAAATCGGTCATCAACCCTACGTTCTTCGATATCGCCTTTTCCAAAGAACCAATCAGCTGTTCAAAAGACGTTT
GCCCTGTTTTAGAAGAGATATACCCATGGCGGCCATATATGAAGCAAGACGAAGCAGGAACGTATCGCTATGTGT
TAGATGTAAGAAGGGTTTATCATTCCTTGGTGATCGTCGCTAATTTTCTTTTTCGTCAGGTTGATGGAAATGGCT
GGTCAGGTCGTTTCAAGCGCCTCATCACCTCTAACTCGTTGATATTCAAATCAACTATATACCCAGAATGGTGCG
TTATGTCTATGGAAAACCATGAACATATCGCGCTAAATCAAGTTCCAGGTACACTGACAGAATTTCTGCCTGGGT
TCATTACGTCCCTGTGCAAGTAGACTTGTCAGATTTACATGACTGTCTAGTCTTTTTTCGCGGTGACGGTAATGG
TGAAGGGTCTCACGACGATTTGGGGAAAAAAATTGCAAAAGCTGGTCGGGAATGGAGTTTGAAGTTCTGGAGACA
CGAAGATATTAATGCTTATTTCTTTCGGTATGTTTTATGTGCTTTACGAGTGCTCATACTCACAGTTCTGTTAGG
TTGATACTAGAGTATGCTCGTTTAATGAGTTCAGATAGGGCAGCGATGTCGTATACTTCAAATTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail