Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|032010
Gene name
Locationscaffold_12:1112710..1114831
Strand+
Gene length (bp)2121
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54PR9|CF60_DICDI Counting factor 60 OS=Dictyostelium discoideum GN=cf60 PE=1 SV=1 84 414 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|032010
MRSISPLWVLLGIAVSFTEAVNVVYYPPDQTHINNLTNVLHSTEAPGIFNSSHTPDSIYGIYNWCNMPHVRTKEY
KTPSSQYKLVYVEAIQRHQKRTPYASNTYFEEVIGWDCVNQGRTVGLHSTSFQETTVEWQAEFPSNNPFTKTVGP
GFINSTCIFPGITSEGQDDARVHGEDLREVYFKRLGLGETYDGKTARVRVTNNVITSEVASGSCRGLWPKTDVVP
VSIEEPVIDSLEPSYPCPNADAIRNNYTTGDGGAVWLNHLTAAAPLFDKLDSISGIEKNDTGGWHISLDHNYDNL
SAKQCHGKPLSCDRNDTSTCVSQEEANMVYNFGNWEYSYIFRDAPESADYSCKKYGAFFLQLQDHLQQVMDGKST
MKFMYNIAHDGSMAPMLGCLQISQMVWPGMGAEVTYELYEGPSNGNNGPGQCNSDITSRDDNSHGNDNHGDDNHG
NNGHGNNGHGNSGNGKQQYYLRVMWGGKPMKTSTPMGTLDLIPVETFFDYIAQYVGTGEELVQLCQSA*
Coding >Agabi119p4|032010
ATGCGCTCCATCTCGCCTCTGTGGGTCCTCCTTGGGATCGCTGTCTCGTTCACTGAGGCAGTGAATGTCGTTTAT
TACCCTCCCGATCAAACTCACATCAACAACTTGACCAACGTCCTCCATTCGACAGAGGCCCCAGGCATTTTCAAC
TCGTCTCACACTCCAGACAGTATATATGGTATCTATAACTGGTGTAACATGCCGCACGTCCGTACCAAGGAGTAC
AAGACTCCTTCGTCACAATACAAGCTAGTATATGTGGAAGCCATTCAACGTCATCAAAAGCGTACTCCATACGCT
TCAAACACATACTTTGAGGAAGTCATTGGCTGGGATTGTGTCAACCAAGGGCGCACAGTTGGACTTCACAGCACA
TCATTCCAAGAGACGACGGTCGAGTGGCAAGCCGAGTTCCCCTCGAATAATCCGTTCACAAAAACGGTAGGCCCG
GGATTCATAAATAGCACTTGCATTTTCCCCGGAATCACGTCCGAAGGTCAGGATGATGCGAGGGTCCATGGTGAA
GATCTAAGAGAGGTCTACTTCAAGCGCCTCGGCCTTGGCGAAACGTATGACGGCAAGACGGCTCGAGTCCGTGTG
ACGAACAATGTGATCACTTCCGAAGTTGCGTCTGGTTCGTGTAGAGGACTTTGGCCGAAGACCGACGTTGTTCCT
GTTTCAATCGAGGAGCCGGTAATCGACTCCCTTGAACCTAGCTACCCCTGTCCCAATGCCGACGCCATCAGGAAC
AATTATACGACCGGTGATGGAGGTGCTGTATGGCTAAACCATTTGACTGCCGCTGCTCCTCTCTTCGACAAGCTA
GACAGTATTTCTGGGATCGAGAAGAACGATACAGGAGGATGGCATATAAGTCTCGACCACAACTACGACAATCTG
AGTGCAAAGCAGTGCCATGGAAAACCACTCTCCTGTGATAGGAACGATACTTCGACGTGTGTTTCACAAGAGGAA
GCCAACATGGTCTACAACTTTGGTAACTGGGAATACTCATACATATTCCGTGATGCCCCAGAATCAGCCGATTAC
TCCTGCAAGAAATATGGTGCCTTTTTCCTACAGCTGCAGGATCATCTCCAACAAGTTATGGATGGCAAATCCACC
ATGAAATTCATGTACAATATTGCTCATGATGGATCTATGGCGCCTATGTTGGGCTGTTTGCAAATCAGTCAAATG
GTCTGGCCGGGAATGGGAGCTGAGGTGACATACGAGCTGTATGAAGGTCCATCTAATGGCAACAATGGTCCTGGC
CAGTGCAACAGCGACATCACCAGCAGGGACGACAACAGTCATGGCAATGACAATCACGGCGATGATAACCACGGC
AATAACGGACATGGCAATAACGGGCATGGCAACAGCGGGAACGGCAAGCAGCAGTACTACTTGCGCGTGATGTGG
GGAGGAAAACCGATGAAGACTTCGACACCTATGGGTACTCTTGATCTAATTCCGGTCGAGACATTCTTTGACTAC
ATTGCGCAATACGTTGGTACTGGTGAGGAGCTTGTGCAGCTATGCCAGTCTGCTTGA
Transcript >Agabi119p4|032010
ATGCGCTCCATCTCGCCTCTGTGGGTCCTCCTTGGGATCGCTGTCTCGTTCACTGAGGCAGTGAATGTCGTTTAT
TACCCTCCCGATCAAACTCACATCAACAACTTGACCAACGTCCTCCATTCGACAGAGGCCCCAGGCATTTTCAAC
TCGTCTCACACTCCAGACAGTATATATGGTATCTATAACTGGTGTAACATGCCGCACGTCCGTACCAAGGAGTAC
AAGACTCCTTCGTCACAATACAAGCTAGTATATGTGGAAGCCATTCAACGTCATCAAAAGCGTACTCCATACGCT
TCAAACACATACTTTGAGGAAGTCATTGGCTGGGATTGTGTCAACCAAGGGCGCACAGTTGGACTTCACAGCACA
TCATTCCAAGAGACGACGGTCGAGTGGCAAGCCGAGTTCCCCTCGAATAATCCGTTCACAAAAACGGTAGGCCCG
GGATTCATAAATAGCACTTGCATTTTCCCCGGAATCACGTCCGAAGGTCAGGATGATGCGAGGGTCCATGGTGAA
GATCTAAGAGAGGTCTACTTCAAGCGCCTCGGCCTTGGCGAAACGTATGACGGCAAGACGGCTCGAGTCCGTGTG
ACGAACAATGTGATCACTTCCGAAGTTGCGTCTGGTTCGTGTAGAGGACTTTGGCCGAAGACCGACGTTGTTCCT
GTTTCAATCGAGGAGCCGGTAATCGACTCCCTTGAACCTAGCTACCCCTGTCCCAATGCCGACGCCATCAGGAAC
AATTATACGACCGGTGATGGAGGTGCTGTATGGCTAAACCATTTGACTGCCGCTGCTCCTCTCTTCGACAAGCTA
GACAGTATTTCTGGGATCGAGAAGAACGATACAGGAGGATGGCATATAAGTCTCGACCACAACTACGACAATCTG
AGTGCAAAGCAGTGCCATGGAAAACCACTCTCCTGTGATAGGAACGATACTTCGACGTGTGTTTCACAAGAGGAA
GCCAACATGGTCTACAACTTTGGTAACTGGGAATACTCATACATATTCCGTGATGCCCCAGAATCAGCCGATTAC
TCCTGCAAGAAATATGGTGCCTTTTTCCTACAGCTGCAGGATCATCTCCAACAAGTTATGGATGGCAAATCCACC
ATGAAATTCATGTACAATATTGCTCATGATGGATCTATGGCGCCTATGTTGGGCTGTTTGCAAATCAGTCAAATG
GTCTGGCCGGGAATGGGAGCTGAGGTGACATACGAGCTGTATGAAGGTCCATCTAATGGCAACAATGGTCCTGGC
CAGTGCAACAGCGACATCACCAGCAGGGACGACAACAGTCATGGCAATGACAATCACGGCGATGATAACCACGGC
AATAACGGACATGGCAATAACGGGCATGGCAACAGCGGGAACGGCAAGCAGCAGTACTACTTGCGCGTGATGTGG
GGAGGAAAACCGATGAAGACTTCGACACCTATGGGTACTCTTGATCTAATTCCGGTCGAGACATTCTTTGACTAC
ATTGCGCAATACGTTGGTACTGGTGAGGAGCTTGTGCAGCTATGCCAGTCTGCTTGA
Gene >Agabi119p4|032010
ATGCGCTCCATCTCGCCTCTGTGGGTCCTCCTTGGGATCGCTGTCTCGTTCACTGAGGCAGTGAATGTCGTTTAT
TACCCTCCCGATCAAACTCACATCAACAACTTGACCAACGTCCTCCATTCGACAGAGGCCCCAGGCATTTTCAAC
TCGTCTCACACTCCAGACAGTATATATGGTATCTATAACTGGTGTAACATGCCGCACGTCCGTACCAAGGAGTAC
AAGTACGTAAATGCCTGTTCCGTACACGTAACTCAATGTTGATCGCCCCTCCATCAAAACCAGGACTCCTTCGTC
ACAATACAAGCTAGTATATGTGGAAGCCATTCAACGTCATCAAAAGCGTACTCCATACGCTTCAAACACATACTT
TGAGGAAGTCATTGGCTGGGATTGTGTCAACCAAGGGCGCACAGTTGGACTTCACAGGTATGCTTTTGGGGTCTG
GCAATCGATCTTAGCCTTTTACTCAAGTGTTGTAGCACATCATTCCAAGAGACGACGGTCGAGGTGTGTTCAATG
ATTTGCTTCAATATCAGCGAGTTACACTGTCTTACATCTGCTAGTGGCAAGCCGAGTTCCCCTCGAATAATCCGT
TCACAAAAACGGTAGGCCCGGGATTCATAAATAGCACGTACGATCTACAATGTTTTCCTACTACTTCCATCTTCT
GAAGCTTCTTCAGTTGCATTTTCCCCGGAATCACGTCCGAAGGTCAGGATGATGCGAGGGTCCATGGTGAAGTGT
GTACTTTTAACGTCAACATTGACGCCACGGGACTCACGATTATATGCAGGATCTAAGAGAGGTCTACTTCAAGCG
CCTCGGCCTTGGCGAAACGTATGACGGCAAGACGGCTCGAGTCCGTGAGTCTCGTTTTCGGATCTACAATTATCC
CTCTTCGTTGACTCTTGATTTTAGGTGTGACGAACAATGTGATCACTTCCGAAGTTGCGTCTGGTTCGTGTAGAG
GACTTTGGCCGAAGACCGACGTTGTTCCTGTTTCAATCGAGGAGCCGGTAATCGACTCCCTTGAACCTAGCTACC
CCTGTCCCAATGCCGACGCCATCAGGAACAATTATACGACCGGTGATGGAGGTGCTGTATGGCTAAACCATTTGA
CTGCCGCTGCTCCTCTCTTCGACAAGCTAGACAGTATTTCTGGGATCGAGAAGAACGATACAGGAGGATGGCATA
TAAGTCTCGACCAGTGAGTATCGCCTCTCGCATAAGTACTTTTTCTTCCATGGCAACTCAATTTTAACTATAGCA
ACTACGACAATCTGAGTGCAAAGCAGTGCCATGGAAAACCACTCTCCTGTGATAGGAACGATACTTCGACGTGTG
TTTCACAAGAGGAAGTAGGTCCATTCAATCTATGATTTTGTGAGCCGTGATTAACTGTTTCGTTTTTTACTCGGT
ATAGGCCAACATGGTCTACAACTTTGGTAACTGGGAATACTCATACATATTCCGTGATGCCCCAGAATCAGCCGA
TTACTCCTGCAAGAAATATGGTGCCTTTTTCCTACAGCTGCAGGATCATCTCCAACAAGTTATGGATGGCAAATC
CACCATGAAATTCATGTACAATGTACGCCATGGACTCGCCCTCTTCTTCAGGAAGCAGCGCTCAACAAACAACTA
TTTAGATTGCTCATGATGGATCTATGGCGCCTATGTTGGGCTGTTTGCAAATCAGTCAAATGGTCTGGCCGGGAA
TGGGAGCTGAGGTGACATACGAGCTGTATGAAGGTCCATCTAATGGCAACAATGGTCCTGGCCAGTGCAACAGCG
ACATCACCAGCAGGGACGACAACAGTCATGGCAATGACAATCACGGCGATGATAACCACGGCAATAACGGACATG
GCAATAACGGGCATGGCAACAGCGGGAACGGCAAGCAGCAGTACTACTTGCGCGTGATGTGGGGAGGAAAACCGA
TGAAGACTTCGACACCTATGGGTACTCTTGATCTAATTCCGGTCGAGACATTCTTTGACTGTAAACCATCTTCTC
TTTTTACCAAAACGACTTCTGACGAAACACTTTATAGACATTGCGCAATACGTTGGTACTGGTGAGGAGCTTGTG
CAGCTATGCCAGTCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail