Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|031890
Gene name
Locationscaffold_12:1076813..1083887
Strand-
Gene length (bp)7074
Transcript length (bp)6711
Coding sequence length (bp)6711
Protein length (aa) 2237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08490 DUF1744 Domain of unknown function (DUF1744) 3.3E-136 1529 1917
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 2.1E-70 120 466
PF00136 DNA_pol_B DNA polymerase family B 4.8E-07 533 892
PF10108 DNA_pol_B_exo2 Predicted 3'-5' exonuclease related to the exonuclease domain of PolB 4.8E-09 376 514

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CUS7|DPOE_KLULA DNA polymerase epsilon catalytic subunit A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=POL2 PE=3 SV=1 33 2228 0.0E+00
sp|P0CN26|DPOE_CRYNJ DNA polymerase epsilon catalytic subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=POL2 PE=3 SV=1 48 2236 0.0E+00
sp|Q54RD4|DPOE1_DICDI DNA polymerase epsilon catalytic subunit A OS=Dictyostelium discoideum GN=pole PE=3 SV=1 74 1977 0.0E+00
sp|Q6C4J0|DPOE_YARLI DNA polymerase epsilon catalytic subunit A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POL2 PE=3 SV=1 63 2225 0.0E+00
sp|F4IFN6|DPOE2_ARATH DNA polymerase epsilon catalytic subunit B OS=Arabidopsis thaliana GN=POL2B PE=2 SV=1 68 2217 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CUS7|DPOE_KLULA DNA polymerase epsilon catalytic subunit A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=POL2 PE=3 SV=1 33 2228 0.0E+00
sp|P0CN26|DPOE_CRYNJ DNA polymerase epsilon catalytic subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=POL2 PE=3 SV=1 48 2236 0.0E+00
sp|Q54RD4|DPOE1_DICDI DNA polymerase epsilon catalytic subunit A OS=Dictyostelium discoideum GN=pole PE=3 SV=1 74 1977 0.0E+00
sp|Q6C4J0|DPOE_YARLI DNA polymerase epsilon catalytic subunit A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POL2 PE=3 SV=1 63 2225 0.0E+00
sp|F4IFN6|DPOE2_ARATH DNA polymerase epsilon catalytic subunit B OS=Arabidopsis thaliana GN=POL2B PE=2 SV=1 68 2217 0.0E+00
sp|F4HW04|DPOE1_ARATH DNA polymerase epsilon catalytic subunit A OS=Arabidopsis thaliana GN=POL2A PE=1 SV=1 71 2217 0.0E+00
sp|Q752B8|DPOE_ASHGO DNA polymerase epsilon catalytic subunit A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=POL2 PE=3 SV=2 74 2225 0.0E+00
sp|P21951|DPOE_YEAST DNA polymerase epsilon catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL2 PE=1 SV=1 37 2220 0.0E+00
sp|Q6FNY7|DPOE_CANGA DNA polymerase epsilon catalytic subunit A OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=POL2 PE=3 SV=1 38 2232 0.0E+00
sp|Q07864|DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens GN=POLE PE=1 SV=5 32 2233 0.0E+00
sp|Q9WVF7|DPOE1_MOUSE DNA polymerase epsilon catalytic subunit A OS=Mus musculus GN=Pole PE=1 SV=3 65 2233 0.0E+00
sp|P87154|DPOE_SCHPO DNA polymerase epsilon catalytic subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol2 PE=2 SV=1 25 2234 0.0E+00
sp|Q6BNG2|DPOE_DEBHA DNA polymerase epsilon catalytic subunit A OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=POL2 PE=3 SV=2 14 2226 0.0E+00
sp|O93845|DPOE_EMENI DNA polymerase epsilon catalytic subunit A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pol2 PE=3 SV=2 53 2234 0.0E+00
sp|Q4WXH8|DPOE_ASPFU DNA polymerase epsilon catalytic subunit A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pol2 PE=3 SV=1 53 2233 0.0E+00
sp|Q4PFV5|DPOE_USTMA DNA polymerase epsilon catalytic subunit A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=POL2 PE=3 SV=1 7 2234 0.0E+00
sp|P0CN27|DPOE_CRYNB DNA polymerase epsilon catalytic subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=POL2 PE=3 SV=1 48 2236 0.0E+00
sp|Q54RD4|DPOE1_DICDI DNA polymerase epsilon catalytic subunit A OS=Dictyostelium discoideum GN=pole PE=3 SV=1 2038 2232 1.0E-29
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 256 609 3.0E-22
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 258 609 2.0E-18
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 258 599 2.0E-17
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 258 635 6.0E-16
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 258 635 6.0E-16
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 258 598 1.0E-15
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 258 599 1.0E-14
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 258 609 3.0E-14
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 258 599 2.0E-13
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 258 599 6.0E-13
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 258 599 8.0E-13
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 257 599 9.0E-13
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 258 599 2.0E-12
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 258 599 2.0E-12
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 258 599 3.0E-12
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 258 599 9.0E-12
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 258 599 1.0E-11
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 258 609 9.0E-11
sp|P18131|DPOL_NPVAC DNA polymerase OS=Autographa californica nuclear polyhedrosis virus GN=POL PE=3 SV=2 308 532 5.0E-08
sp|P41712|DPOL_NPVBM DNA polymerase OS=Bombyx mori nuclear polyhedrosis virus GN=POL PE=3 SV=2 308 532 2.0E-07
sp|O50607|DPOL1_SULOH DNA polymerase 1 OS=Sulfurisphaera ohwakuensis GN=pol-alpha PE=3 SV=1 290 598 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0008270 zinc ion binding Yes
GO:0000166 nucleotide binding Yes
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0036094 small molecule binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0046872 metal ion binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043169 cation binding No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0016779 nucleotidyltransferase activity No
GO:0034061 DNA polymerase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140097 catalytic activity, acting on DNA No
GO:0009987 cellular process No
GO:0043226 organelle No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|031890
MGRGRGFGLSSNQGKRGSGSRFNYRGNSSWRGGRGRGRGRGRGGASLPSDSPTPVREDDGTLLAERFEKVTLSDE
IDEKMGFPRVQEGGKREGWLVNMRPTLVKDPEWASGKAAVDFYFIQDDGGMFKCTFLYEPYFCIACKPGTETAVE
EWLRKKYEGLISRIVRDWKEDLKLPNHLMGHRRLYLQLCFRNVGDLLAVRRDIVPLAQTNGAKRDAVDAYAEVVS
ATTGAASMDVDFEGELEGSSLKNSGREKDPRECIIDVREYDVPYYLRVAIDVEIRVGLWYTVTFNEGQPSFSQMV
ERVKRADPVVMAYDIETTKAPLKFPDQAIDQVMMISYMIDGQGYLITNREIVSEDIDDFEYTPKEGYEGPFTVFN
ERNEAETIRRFFSHIQEVKPTVMATFNGDFFDFPFLDARAQVNGIDMYLETGFAKDQEDEYKSNNCAHMDCFRWV
KRDSYLPQGSQGLKAVTTAKLGYNPIELDPELMTPYAMEQPQILAQYSVSDAVATYYLYMKYVHPFIFSLCNIIP
LNPDEVLRKGSGTLCETLLMVEAFRGHIIMPNRHEESHGNMHEGHLLASETYVGGHVEALEAGVFRSDIDTDFKI
VPAAVQKLIDELDAALTFCIVEESKANLEDVTNYDQIKQEIQTALEVMRDNPRRTDKPLIYHLDVAAMYPNIMLS
NRLQPDSMVDESVCAVCDHNRPGKTCDRRLKWAWRGEFFPAHRDEFNMIKHALNQEDFPPKRPGGPKRKFVDLAP
SEQTALLHKRLGDYSRKVYAKTRETKVEHREAIVCQKENPFYVDTVRRFRDRRYEYKGLLKKAKGALDSVLDEGR
SLAEVDEAKKMIVLYDSLQLAHKCILNSFYGYVMRKGARWHSMEMAGITCLTGSTIIQMARALVEQIGRPLELDT
DGIWCMLPGVFPENFKFKLANGKAIGFSYPCTMLNHLVYAQFTNHQYHDFDPETGEYKVHSENSIFFELDGPYKA
MILPSSKEEDKLLKKRYAVFNDDGSLAELKGFEVKRRGELQLIKIFQSQLFEKFLLGSTTQECYAFVAQIANQWL
DVLDSRAKDLTDEELVELIAENRSMSRTLAEYAGQKSTSISTARRLAEFLGDQMVKDKGLACKFIISAKPLGAPV
TERAVPVAIFSAEESVKRVYLRKWLKDNGLINFDLRSILDWEYYIERLGSVIQKLITIPAAMQKVANPVPRIAHP
DWLHRRIVKLTEKFKQNKMTDFFGKKESKEDQETQPMDIEDAGGSEGAKTGIQKFAVIRKKIRERTPEVKEPEEI
PIPNPNLHYRDWIKAMRPRWRKRRELRNGDGESASVVIPSMFNGAKVRTRNRWDVVQIRPTSTPGRFILWLSVGS
ELVAAPIRIPRQFYIHMKTPRENLFWPGYYHYEKVTRNLPHELPCDNLYKITVREETYHDIREHFIDLTNDPNVD
GVYEQQVPLALRAIIKLGKTCSAEDASLTLNRAQTVGFDLEQLDKAGTSRQPCVRSETGKYIFLYHACSANAPLH
VFTLFLPNGSAKLHIVDPATRRQAIPRLQEQYSSQLRQFREQYDAPKSYNYVETLDISTTYHSNDVTALKAISRE
LGLLEDKSFTVVISSSKDDAYFEQQLPKLAKFPTLSMPKAKAPHTLDVFPWQTHVAAKLMTRYLTMGSWIDRLVT
LADYYDIPMGHIEGDQPLHCIDVNFARKLIQQDIVLWWSSGERPDLGGIENDTHLSEDFPETEFSSPGVYSNVCL
EITLRNLAVNSVLQSQLVNELEGSGGSTAFDSISHTLNEYSKADGQRELTLAESQISSQTFGIIRSLVKAWLLDK
VRNDYESPAALAVDHFWRWVSSTTSGLYDPTIHRFIHGLMRKTFIQLIAEFKRLGSTVVYADFSSILLATSKPPG
TAYAYATYIATAATSNELFQHIYLNTEKFYDFLIFMDRANMSAIHCEDPLATEPSNHISLEMRWNIQQFLPPAIH
DDFAQIVQFYLIQLFKIKQKSNAIARKPLRILENGAPDNTQRDAAKSSESESIVEFIAHKLTSKMLKTVGSMQER
YRESMMDEEVAKSFEFPTLPGGYLHFDNPTLEFIKSVCEIFSLAKAYDVEIRLMKRNLLELVGVREFAMEAAFKN
PCEPLKLSNVPCSHCDVLRDFDFCRDPDLAASGQSATPKWYCSSCNGEYDRVAIEFMLIGVVQAIEASFAQQDLR
CPKCKQIRSDNLSRHCQCSGSYLYTSNKVDARRKLRTMVNIAIFYNLPRLKESSQMLLANW*
Coding >Agabi119p4|031890
ATGGGTCGGGGACGTGGCTTCGGCCTCTCTTCAAATCAAGGAAAGCGCGGCTCAGGATCCCGCTTCAATTACCGC
GGAAACAGCTCCTGGCGTGGTGGAAGGGGACGGGGACGAGGACGGGGACGGGGTGGTGCTAGTCTTCCAAGTGAT
TCTCCAACACCCGTACGCGAAGATGATGGCACACTGCTTGCGGAAAGATTCGAAAAGGTCACTCTGAGCGATGAA
ATAGACGAGAAGATGGGATTTCCGAGGGTTCAGGAAGGTGGTAAGAGGGAAGGTTGGTTGGTCAATATGCGACCA
ACCTTAGTGAAGGATCCGGAATGGGCATCAGGAAAAGCTGCAGTCGATTTCTATTTTATTCAAGATGACGGTGGT
ATGTTCAAATGTACATTCCTATACGAACCGTATTTTTGCATCGCGTGCAAGCCTGGAACAGAAACTGCCGTCGAG
GAGTGGCTACGAAAGAAATACGAGGGCCTCATATCTCGCATCGTCCGCGACTGGAAAGAAGACCTCAAATTACCG
AACCACCTAATGGGTCACCGACGACTTTACCTCCAGTTATGTTTTCGCAATGTCGGAGACTTGCTTGCTGTACGA
CGAGATATAGTTCCTCTTGCACAAACGAATGGTGCAAAGCGAGATGCGGTTGATGCCTACGCAGAAGTTGTGAGC
GCCACAACGGGAGCAGCCAGTATGGACGTCGACTTCGAAGGAGAATTGGAAGGTTCATCTCTCAAGAATTCTGGT
CGCGAGAAGGATCCTCGCGAATGCATCATCGATGTCCGCGAATATGATGTCCCTTATTACCTTCGCGTTGCTATC
GACGTTGAAATTCGCGTGGGACTCTGGTATACAGTTACCTTCAATGAAGGCCAACCAAGTTTCTCTCAAATGGTT
GAGCGTGTCAAACGTGCCGATCCGGTTGTCATGGCCTATGATATAGAAACCACCAAGGCTCCCTTGAAATTTCCG
GACCAGGCGATTGACCAAGTAATGATGATTTCTTATATGATTGATGGCCAAGGCTACTTGATAACCAACCGAGAA
ATTGTCAGCGAAGACATTGATGACTTTGAATATACGCCCAAGGAAGGTTATGAAGGACCTTTTACGGTCTTCAAT
GAACGAAACGAAGCTGAAACTATTCGACGCTTCTTTTCTCATATTCAGGAAGTTAAACCGACGGTTATGGCTACG
TTCAACGGAGACTTTTTCGATTTCCCTTTCTTGGATGCTCGTGCCCAAGTCAATGGTATCGACATGTACCTAGAG
ACCGGATTTGCGAAGGACCAAGAAGACGAATACAAGAGTAACAACTGTGCTCACATGGACTGTTTCCGATGGGTC
AAACGTGATTCATACTTGCCTCAAGGAAGTCAAGGCCTAAAAGCCGTTACTACCGCGAAGCTGGGATATAATCCA
ATTGAATTGGATCCGGAACTCATGACGCCTTATGCTATGGAGCAACCCCAAATCTTGGCTCAATATTCCGTTTCC
GACGCAGTGGCGACGTACTACCTGTACATGAAATATGTCCACCCGTTCATCTTCTCCTTGTGCAATATCATTCCT
CTCAATCCCGATGAAGTTTTAAGGAAGGGTAGTGGAACACTATGTGAGACGCTCCTCATGGTCGAGGCGTTCCGT
GGCCACATTATAATGCCAAACAGGCACGAAGAGTCTCATGGTAACATGCATGAAGGTCATCTTCTTGCTTCTGAG
ACCTACGTCGGTGGACATGTCGAAGCTCTCGAAGCTGGCGTATTTCGCAGTGATATCGACACTGATTTCAAGATC
GTACCCGCGGCAGTTCAAAAGCTGATTGATGAATTGGACGCAGCTCTCACATTTTGTATCGTGGAGGAGTCAAAA
GCAAATCTCGAAGATGTTACCAACTATGATCAAATCAAACAAGAGATTCAAACGGCTCTCGAGGTCATGCGAGAT
AATCCGAGGCGTACGGATAAACCCCTCATTTATCATTTGGATGTCGCTGCTATGTATCCAAACATCATGTTATCC
AACCGTCTTCAACCCGATTCCATGGTCGACGAGTCTGTTTGCGCAGTTTGCGATCATAATCGTCCCGGAAAAACT
TGTGATCGTCGATTGAAGTGGGCTTGGAGAGGAGAGTTCTTCCCTGCTCATCGAGACGAGTTCAATATGATCAAA
CATGCCCTCAACCAGGAGGATTTTCCTCCCAAGAGACCTGGAGGTCCCAAACGCAAGTTTGTGGATTTGGCACCT
TCGGAGCAGACTGCTCTTCTCCATAAACGTTTAGGGGATTATTCGCGCAAGGTGTATGCCAAGACGCGAGAGACA
AAAGTCGAACACCGCGAAGCGATTGTATGTCAGAAGGAAAATCCTTTTTATGTTGATACTGTGCGACGATTCCGA
GATCGACGTTACGAGTATAAAGGTTTACTCAAGAAAGCTAAGGGTGCTCTTGACTCTGTGCTTGATGAGGGTCGT
TCTCTTGCAGAGGTCGATGAAGCCAAGAAAATGATCGTATTGTACGATTCTCTGCAGCTCGCTCACAAGTGTATC
CTGAATTCCTTTTATGGCTATGTCATGAGGAAGGGTGCTCGTTGGCATTCGATGGAGATGGCGGGAATTACGTGT
TTGACGGGTTCGACTATCATTCAGATGGCGCGTGCTCTGGTTGAACAGATTGGAAGGCCGTTGGAGTTGGATACG
GATGGTATTTGGTGTATGCTTCCTGGAGTGTTTCCTGAAAACTTCAAGTTCAAGCTCGCGAACGGGAAGGCAATT
GGGTTTTCGTATCCCTGTACCATGCTCAATCATCTGGTCTACGCCCAATTCACTAATCATCAGTATCACGACTTT
GATCCTGAAACGGGGGAATACAAGGTCCATAGCGAGAACTCTATCTTCTTCGAGTTGGATGGTCCTTACAAGGCT
ATGATCTTGCCATCATCCAAGGAAGAGGATAAATTGTTGAAGAAACGTTACGCGGTTTTCAATGACGACGGTTCG
CTTGCGGAGTTGAAGGGATTCGAAGTCAAAAGACGAGGAGAACTTCAATTGATCAAGATCTTCCAATCTCAACTG
TTTGAGAAATTCCTTCTTGGTTCTACTACTCAGGAATGTTATGCTTTTGTGGCGCAAATTGCTAATCAATGGCTT
GACGTGTTGGATAGTCGAGCAAAAGACTTGACTGATGAAGAGCTCGTTGAACTTATTGCTGAAAATCGTAGCATG
TCAAGGACGCTTGCTGAATATGCTGGTCAGAAGTCGACGTCTATTAGTACGGCACGGCGTTTGGCAGAGTTTTTG
GGAGATCAGATGGTGAAGGATAAAGGATTGGCATGCAAATTTATTATTTCTGCGAAACCGTTGGGGGCTCCTGTA
ACGGAACGTGCTGTTCCAGTTGCAATCTTTTCTGCGGAGGAGAGTGTGAAGAGGGTGTATTTGAGGAAATGGTTG
AAGGATAATGGTCTCATCAATTTCGATTTGAGGTCGATTTTGGATTGGGAGTATTATATTGAGAGGTTGGGTTCG
GTGATTCAGAAGCTTATTACTATTCCTGCGGCGATGCAGAAGGTGGCTAATCCTGTTCCGAGGATCGCTCATCCG
GATTGGTTGCATCGGAGGATTGTGAAGTTGACGGAGAAGTTCAAGCAGAACAAGATGACGGATTTTTTCGGGAAG
AAAGAGTCGAAGGAGGATCAGGAAACTCAGCCGATGGATATTGAAGATGCGGGTGGTAGTGAGGGTGCGAAAACT
GGGATACAGAAGTTTGCTGTTATCAGGAAGAAGATTCGTGAAAGGACACCTGAGGTGAAGGAACCGGAAGAGATA
CCCATACCGAATCCCAATCTACACTATCGCGATTGGATCAAGGCAATGCGACCACGATGGAGGAAAAGGAGAGAA
CTACGTAATGGCGATGGTGAAAGTGCTTCTGTTGTTATTCCGAGCATGTTCAATGGGGCGAAGGTCCGGACGAGG
AATCGTTGGGATGTTGTTCAAATTCGACCGACTTCGACACCAGGCCGGTTTATACTATGGCTGTCTGTTGGTTCT
GAATTGGTGGCGGCGCCCATTCGGATCCCTCGTCAATTTTATATCCATATGAAGACACCACGGGAAAACCTATTT
TGGCCAGGATATTATCACTACGAGAAGGTTACTCGTAACTTGCCGCACGAGCTTCCTTGCGACAATCTTTATAAG
ATTACGGTTCGCGAGGAGACTTATCATGACATCAGGGAACATTTCATTGATCTGACGAATGACCCAAATGTGGAT
GGCGTATATGAGCAACAGGTTCCTCTGGCTCTTCGGGCAATCATAAAACTTGGGAAAACATGTTCAGCAGAGGAT
GCAAGTCTTACATTGAACCGCGCTCAGACTGTTGGCTTCGACCTAGAACAACTGGACAAAGCAGGTACATCTCGC
CAGCCTTGCGTTAGGAGTGAAACCGGAAAGTACATCTTCCTCTACCACGCTTGCTCGGCAAACGCTCCTCTCCAT
GTCTTTACTCTCTTTTTGCCAAACGGATCCGCCAAGCTACATATTGTCGATCCCGCTACACGTCGTCAAGCCATT
CCTCGACTACAAGAACAGTATTCTAGTCAGCTACGACAATTCCGAGAGCAGTATGATGCACCCAAGTCATATAAT
TACGTGGAAACCTTGGATATTTCGACCACATATCATAGTAATGATGTGACGGCTCTCAAAGCGATATCGCGTGAG
CTAGGACTGCTCGAAGACAAGTCATTTACAGTCGTCATCTCGTCGAGCAAGGACGACGCGTATTTTGAGCAGCAG
CTTCCCAAGCTTGCAAAGTTCCCGACGTTGTCTATGCCCAAGGCAAAGGCACCACACACTCTCGATGTCTTCCCG
TGGCAGACTCATGTCGCTGCGAAATTGATGACTCGATATCTCACTATGGGAAGTTGGATCGATCGCTTGGTGACA
CTTGCCGACTATTATGATATTCCGATGGGTCATATTGAAGGAGATCAGCCGCTACACTGTATCGATGTCAATTTT
GCTCGGAAATTGATTCAACAGGATATCGTTCTTTGGTGGTCTTCTGGCGAACGACCTGACTTGGGAGGTATCGAG
AATGACACGCATTTATCTGAAGATTTTCCCGAAACCGAATTTTCGAGTCCCGGAGTCTACTCCAATGTCTGCCTC
GAGATAACGCTTAGGAATTTGGCAGTAAATAGTGTGCTACAATCTCAGTTGGTTAACGAATTGGAAGGAAGTGGA
GGGTCGACAGCGTTTGATTCTATATCTCATACCCTAAACGAGTACTCGAAAGCGGATGGTCAGAGGGAATTGACG
TTGGCAGAGTCACAGATTTCCTCCCAGACTTTTGGAATTATTCGGTCCCTGGTTAAAGCTTGGCTCCTTGACAAA
GTTCGTAACGACTATGAAAGTCCGGCGGCCCTTGCGGTGGATCATTTTTGGCGATGGGTCAGCTCGACTACCTCT
GGTCTATACGATCCTACAATTCACCGATTCATCCACGGTTTGATGCGCAAAACCTTCATCCAGCTGATTGCGGAA
TTCAAGCGCCTTGGCTCAACAGTCGTCTATGCTGACTTTAGCAGTATTTTGTTGGCTACCTCAAAACCTCCGGGC
ACTGCATACGCCTATGCGACTTATATTGCCACCGCTGCTACTTCCAATGAACTTTTCCAGCATATCTACTTGAAC
ACGGAAAAGTTTTACGATTTCCTCATCTTCATGGACCGGGCAAACATGTCTGCCATCCACTGTGAAGACCCTTTG
GCAACGGAACCATCGAATCACATTTCCCTCGAGATGCGGTGGAACATCCAGCAGTTTTTACCTCCTGCTATCCAT
GACGATTTTGCTCAGATCGTTCAATTCTACTTGATTCAACTTTTCAAAATCAAGCAGAAAAGCAATGCCATTGCA
AGAAAACCTTTACGAATCCTCGAGAACGGCGCGCCCGATAATACCCAACGAGATGCTGCGAAGTCGAGCGAATCC
GAATCGATAGTGGAATTCATTGCTCATAAGCTGACCTCAAAAATGTTGAAAACAGTTGGGTCCATGCAGGAGCGC
TATCGTGAGTCTATGATGGATGAGGAAGTTGCCAAAAGCTTCGAATTTCCTACATTGCCGGGTGGCTATCTTCAC
TTTGATAACCCTACCTTGGAGTTCATCAAGTCCGTCTGCGAAATTTTTTCCCTTGCCAAAGCATATGACGTCGAG
ATCCGGTTGATGAAGCGAAATCTACTGGAGCTGGTTGGCGTACGGGAATTTGCGATGGAGGCTGCATTCAAGAAC
CCCTGCGAACCCCTCAAACTGTCGAATGTACCTTGCTCCCATTGCGATGTCCTTCGCGACTTCGACTTTTGTAGA
GACCCAGATCTGGCTGCAAGTGGACAGTCGGCAACTCCAAAATGGTATTGCTCAAGTTGCAACGGAGAATATGAC
CGAGTAGCCATCGAATTCATGCTGATTGGGGTCGTTCAAGCTATCGAAGCCAGCTTTGCGCAGCAAGATCTTCGA
TGTCCCAAGTGCAAACAAATCCGATCAGACAACTTATCTAGACACTGTCAATGCTCAGGATCTTATCTCTATACA
TCGAACAAAGTGGATGCACGTCGGAAATTGCGCACTATGGTTAACATCGCTATTTTCTATAATTTACCTCGCCTC
AAGGAATCATCTCAAATGTTACTCGCAAACTGGTAA
Transcript >Agabi119p4|031890
ATGGGTCGGGGACGTGGCTTCGGCCTCTCTTCAAATCAAGGAAAGCGCGGCTCAGGATCCCGCTTCAATTACCGC
GGAAACAGCTCCTGGCGTGGTGGAAGGGGACGGGGACGAGGACGGGGACGGGGTGGTGCTAGTCTTCCAAGTGAT
TCTCCAACACCCGTACGCGAAGATGATGGCACACTGCTTGCGGAAAGATTCGAAAAGGTCACTCTGAGCGATGAA
ATAGACGAGAAGATGGGATTTCCGAGGGTTCAGGAAGGTGGTAAGAGGGAAGGTTGGTTGGTCAATATGCGACCA
ACCTTAGTGAAGGATCCGGAATGGGCATCAGGAAAAGCTGCAGTCGATTTCTATTTTATTCAAGATGACGGTGGT
ATGTTCAAATGTACATTCCTATACGAACCGTATTTTTGCATCGCGTGCAAGCCTGGAACAGAAACTGCCGTCGAG
GAGTGGCTACGAAAGAAATACGAGGGCCTCATATCTCGCATCGTCCGCGACTGGAAAGAAGACCTCAAATTACCG
AACCACCTAATGGGTCACCGACGACTTTACCTCCAGTTATGTTTTCGCAATGTCGGAGACTTGCTTGCTGTACGA
CGAGATATAGTTCCTCTTGCACAAACGAATGGTGCAAAGCGAGATGCGGTTGATGCCTACGCAGAAGTTGTGAGC
GCCACAACGGGAGCAGCCAGTATGGACGTCGACTTCGAAGGAGAATTGGAAGGTTCATCTCTCAAGAATTCTGGT
CGCGAGAAGGATCCTCGCGAATGCATCATCGATGTCCGCGAATATGATGTCCCTTATTACCTTCGCGTTGCTATC
GACGTTGAAATTCGCGTGGGACTCTGGTATACAGTTACCTTCAATGAAGGCCAACCAAGTTTCTCTCAAATGGTT
GAGCGTGTCAAACGTGCCGATCCGGTTGTCATGGCCTATGATATAGAAACCACCAAGGCTCCCTTGAAATTTCCG
GACCAGGCGATTGACCAAGTAATGATGATTTCTTATATGATTGATGGCCAAGGCTACTTGATAACCAACCGAGAA
ATTGTCAGCGAAGACATTGATGACTTTGAATATACGCCCAAGGAAGGTTATGAAGGACCTTTTACGGTCTTCAAT
GAACGAAACGAAGCTGAAACTATTCGACGCTTCTTTTCTCATATTCAGGAAGTTAAACCGACGGTTATGGCTACG
TTCAACGGAGACTTTTTCGATTTCCCTTTCTTGGATGCTCGTGCCCAAGTCAATGGTATCGACATGTACCTAGAG
ACCGGATTTGCGAAGGACCAAGAAGACGAATACAAGAGTAACAACTGTGCTCACATGGACTGTTTCCGATGGGTC
AAACGTGATTCATACTTGCCTCAAGGAAGTCAAGGCCTAAAAGCCGTTACTACCGCGAAGCTGGGATATAATCCA
ATTGAATTGGATCCGGAACTCATGACGCCTTATGCTATGGAGCAACCCCAAATCTTGGCTCAATATTCCGTTTCC
GACGCAGTGGCGACGTACTACCTGTACATGAAATATGTCCACCCGTTCATCTTCTCCTTGTGCAATATCATTCCT
CTCAATCCCGATGAAGTTTTAAGGAAGGGTAGTGGAACACTATGTGAGACGCTCCTCATGGTCGAGGCGTTCCGT
GGCCACATTATAATGCCAAACAGGCACGAAGAGTCTCATGGTAACATGCATGAAGGTCATCTTCTTGCTTCTGAG
ACCTACGTCGGTGGACATGTCGAAGCTCTCGAAGCTGGCGTATTTCGCAGTGATATCGACACTGATTTCAAGATC
GTACCCGCGGCAGTTCAAAAGCTGATTGATGAATTGGACGCAGCTCTCACATTTTGTATCGTGGAGGAGTCAAAA
GCAAATCTCGAAGATGTTACCAACTATGATCAAATCAAACAAGAGATTCAAACGGCTCTCGAGGTCATGCGAGAT
AATCCGAGGCGTACGGATAAACCCCTCATTTATCATTTGGATGTCGCTGCTATGTATCCAAACATCATGTTATCC
AACCGTCTTCAACCCGATTCCATGGTCGACGAGTCTGTTTGCGCAGTTTGCGATCATAATCGTCCCGGAAAAACT
TGTGATCGTCGATTGAAGTGGGCTTGGAGAGGAGAGTTCTTCCCTGCTCATCGAGACGAGTTCAATATGATCAAA
CATGCCCTCAACCAGGAGGATTTTCCTCCCAAGAGACCTGGAGGTCCCAAACGCAAGTTTGTGGATTTGGCACCT
TCGGAGCAGACTGCTCTTCTCCATAAACGTTTAGGGGATTATTCGCGCAAGGTGTATGCCAAGACGCGAGAGACA
AAAGTCGAACACCGCGAAGCGATTGTATGTCAGAAGGAAAATCCTTTTTATGTTGATACTGTGCGACGATTCCGA
GATCGACGTTACGAGTATAAAGGTTTACTCAAGAAAGCTAAGGGTGCTCTTGACTCTGTGCTTGATGAGGGTCGT
TCTCTTGCAGAGGTCGATGAAGCCAAGAAAATGATCGTATTGTACGATTCTCTGCAGCTCGCTCACAAGTGTATC
CTGAATTCCTTTTATGGCTATGTCATGAGGAAGGGTGCTCGTTGGCATTCGATGGAGATGGCGGGAATTACGTGT
TTGACGGGTTCGACTATCATTCAGATGGCGCGTGCTCTGGTTGAACAGATTGGAAGGCCGTTGGAGTTGGATACG
GATGGTATTTGGTGTATGCTTCCTGGAGTGTTTCCTGAAAACTTCAAGTTCAAGCTCGCGAACGGGAAGGCAATT
GGGTTTTCGTATCCCTGTACCATGCTCAATCATCTGGTCTACGCCCAATTCACTAATCATCAGTATCACGACTTT
GATCCTGAAACGGGGGAATACAAGGTCCATAGCGAGAACTCTATCTTCTTCGAGTTGGATGGTCCTTACAAGGCT
ATGATCTTGCCATCATCCAAGGAAGAGGATAAATTGTTGAAGAAACGTTACGCGGTTTTCAATGACGACGGTTCG
CTTGCGGAGTTGAAGGGATTCGAAGTCAAAAGACGAGGAGAACTTCAATTGATCAAGATCTTCCAATCTCAACTG
TTTGAGAAATTCCTTCTTGGTTCTACTACTCAGGAATGTTATGCTTTTGTGGCGCAAATTGCTAATCAATGGCTT
GACGTGTTGGATAGTCGAGCAAAAGACTTGACTGATGAAGAGCTCGTTGAACTTATTGCTGAAAATCGTAGCATG
TCAAGGACGCTTGCTGAATATGCTGGTCAGAAGTCGACGTCTATTAGTACGGCACGGCGTTTGGCAGAGTTTTTG
GGAGATCAGATGGTGAAGGATAAAGGATTGGCATGCAAATTTATTATTTCTGCGAAACCGTTGGGGGCTCCTGTA
ACGGAACGTGCTGTTCCAGTTGCAATCTTTTCTGCGGAGGAGAGTGTGAAGAGGGTGTATTTGAGGAAATGGTTG
AAGGATAATGGTCTCATCAATTTCGATTTGAGGTCGATTTTGGATTGGGAGTATTATATTGAGAGGTTGGGTTCG
GTGATTCAGAAGCTTATTACTATTCCTGCGGCGATGCAGAAGGTGGCTAATCCTGTTCCGAGGATCGCTCATCCG
GATTGGTTGCATCGGAGGATTGTGAAGTTGACGGAGAAGTTCAAGCAGAACAAGATGACGGATTTTTTCGGGAAG
AAAGAGTCGAAGGAGGATCAGGAAACTCAGCCGATGGATATTGAAGATGCGGGTGGTAGTGAGGGTGCGAAAACT
GGGATACAGAAGTTTGCTGTTATCAGGAAGAAGATTCGTGAAAGGACACCTGAGGTGAAGGAACCGGAAGAGATA
CCCATACCGAATCCCAATCTACACTATCGCGATTGGATCAAGGCAATGCGACCACGATGGAGGAAAAGGAGAGAA
CTACGTAATGGCGATGGTGAAAGTGCTTCTGTTGTTATTCCGAGCATGTTCAATGGGGCGAAGGTCCGGACGAGG
AATCGTTGGGATGTTGTTCAAATTCGACCGACTTCGACACCAGGCCGGTTTATACTATGGCTGTCTGTTGGTTCT
GAATTGGTGGCGGCGCCCATTCGGATCCCTCGTCAATTTTATATCCATATGAAGACACCACGGGAAAACCTATTT
TGGCCAGGATATTATCACTACGAGAAGGTTACTCGTAACTTGCCGCACGAGCTTCCTTGCGACAATCTTTATAAG
ATTACGGTTCGCGAGGAGACTTATCATGACATCAGGGAACATTTCATTGATCTGACGAATGACCCAAATGTGGAT
GGCGTATATGAGCAACAGGTTCCTCTGGCTCTTCGGGCAATCATAAAACTTGGGAAAACATGTTCAGCAGAGGAT
GCAAGTCTTACATTGAACCGCGCTCAGACTGTTGGCTTCGACCTAGAACAACTGGACAAAGCAGGTACATCTCGC
CAGCCTTGCGTTAGGAGTGAAACCGGAAAGTACATCTTCCTCTACCACGCTTGCTCGGCAAACGCTCCTCTCCAT
GTCTTTACTCTCTTTTTGCCAAACGGATCCGCCAAGCTACATATTGTCGATCCCGCTACACGTCGTCAAGCCATT
CCTCGACTACAAGAACAGTATTCTAGTCAGCTACGACAATTCCGAGAGCAGTATGATGCACCCAAGTCATATAAT
TACGTGGAAACCTTGGATATTTCGACCACATATCATAGTAATGATGTGACGGCTCTCAAAGCGATATCGCGTGAG
CTAGGACTGCTCGAAGACAAGTCATTTACAGTCGTCATCTCGTCGAGCAAGGACGACGCGTATTTTGAGCAGCAG
CTTCCCAAGCTTGCAAAGTTCCCGACGTTGTCTATGCCCAAGGCAAAGGCACCACACACTCTCGATGTCTTCCCG
TGGCAGACTCATGTCGCTGCGAAATTGATGACTCGATATCTCACTATGGGAAGTTGGATCGATCGCTTGGTGACA
CTTGCCGACTATTATGATATTCCGATGGGTCATATTGAAGGAGATCAGCCGCTACACTGTATCGATGTCAATTTT
GCTCGGAAATTGATTCAACAGGATATCGTTCTTTGGTGGTCTTCTGGCGAACGACCTGACTTGGGAGGTATCGAG
AATGACACGCATTTATCTGAAGATTTTCCCGAAACCGAATTTTCGAGTCCCGGAGTCTACTCCAATGTCTGCCTC
GAGATAACGCTTAGGAATTTGGCAGTAAATAGTGTGCTACAATCTCAGTTGGTTAACGAATTGGAAGGAAGTGGA
GGGTCGACAGCGTTTGATTCTATATCTCATACCCTAAACGAGTACTCGAAAGCGGATGGTCAGAGGGAATTGACG
TTGGCAGAGTCACAGATTTCCTCCCAGACTTTTGGAATTATTCGGTCCCTGGTTAAAGCTTGGCTCCTTGACAAA
GTTCGTAACGACTATGAAAGTCCGGCGGCCCTTGCGGTGGATCATTTTTGGCGATGGGTCAGCTCGACTACCTCT
GGTCTATACGATCCTACAATTCACCGATTCATCCACGGTTTGATGCGCAAAACCTTCATCCAGCTGATTGCGGAA
TTCAAGCGCCTTGGCTCAACAGTCGTCTATGCTGACTTTAGCAGTATTTTGTTGGCTACCTCAAAACCTCCGGGC
ACTGCATACGCCTATGCGACTTATATTGCCACCGCTGCTACTTCCAATGAACTTTTCCAGCATATCTACTTGAAC
ACGGAAAAGTTTTACGATTTCCTCATCTTCATGGACCGGGCAAACATGTCTGCCATCCACTGTGAAGACCCTTTG
GCAACGGAACCATCGAATCACATTTCCCTCGAGATGCGGTGGAACATCCAGCAGTTTTTACCTCCTGCTATCCAT
GACGATTTTGCTCAGATCGTTCAATTCTACTTGATTCAACTTTTCAAAATCAAGCAGAAAAGCAATGCCATTGCA
AGAAAACCTTTACGAATCCTCGAGAACGGCGCGCCCGATAATACCCAACGAGATGCTGCGAAGTCGAGCGAATCC
GAATCGATAGTGGAATTCATTGCTCATAAGCTGACCTCAAAAATGTTGAAAACAGTTGGGTCCATGCAGGAGCGC
TATCGTGAGTCTATGATGGATGAGGAAGTTGCCAAAAGCTTCGAATTTCCTACATTGCCGGGTGGCTATCTTCAC
TTTGATAACCCTACCTTGGAGTTCATCAAGTCCGTCTGCGAAATTTTTTCCCTTGCCAAAGCATATGACGTCGAG
ATCCGGTTGATGAAGCGAAATCTACTGGAGCTGGTTGGCGTACGGGAATTTGCGATGGAGGCTGCATTCAAGAAC
CCCTGCGAACCCCTCAAACTGTCGAATGTACCTTGCTCCCATTGCGATGTCCTTCGCGACTTCGACTTTTGTAGA
GACCCAGATCTGGCTGCAAGTGGACAGTCGGCAACTCCAAAATGGTATTGCTCAAGTTGCAACGGAGAATATGAC
CGAGTAGCCATCGAATTCATGCTGATTGGGGTCGTTCAAGCTATCGAAGCCAGCTTTGCGCAGCAAGATCTTCGA
TGTCCCAAGTGCAAACAAATCCGATCAGACAACTTATCTAGACACTGTCAATGCTCAGGATCTTATCTCTATACA
TCGAACAAAGTGGATGCACGTCGGAAATTGCGCACTATGGTTAACATCGCTATTTTCTATAATTTACCTCGCCTC
AAGGAATCATCTCAAATGTTACTCGCAAACTGGTAA
Gene >Agabi119p4|031890
ATGGGTCGGGGACGTGGCTTCGGCCTCTCTTCAAATCAAGGAAAGCGCGGCTCAGGATCCCGCTTCAATTACCGC
GGAAACAGCTCCTGGCGTGGTGGAAGGGGACGGGGACGAGGACGGGGACGGGGTGGTGCTAGTCTTCCAAGTGAT
TCTCCAACACCCGTACGCGAAGATGATGGCACACTGCTTGCGGAAAGATTCGAAAAGGTCACTCTGAGCGATGAA
ATAGACGAGAAGATGGGATTTCCGAGGGTTCAGGAAGGTGGTAAGAGGGAAGGTTGGTTGGTCAATATGCGACCA
GTACGTCATATCTTCCTCTTCATTTGATTCGAACCTTGATGGCTGGTAGACCTTAGTGAAGGATCCGGAATGGGC
ATCAGGAAAAGCTGCAGTCGATTTCTATTTTATTCAAGATGACGGTGGTATGTTCAAATGTACATTCCTATACGA
ACCGTATTTTTGCATCGCGTGCAAGGTTCGTTTCGTCCTCAGCCATAGCACGCCTGTGATATTAATTTTGGCAGC
CTGGAACAGAAACTGCCGTCGAGGAGTGGCTACGAAAGAAATACGAGGGCCTCATATCTCGCATCGTCCGCGACT
GGAAAGAAGACCTCAAATTACCGAACCACCTAATGGGTCACCGACGACTTTACCTCCAGTTATGTTTTCGCAATG
TCGGAGACTTGCTTGCTGTACGACGAGATATAGTTCCTCTTGCACAAACGAATGGTGCAAAGCGAGATGCGGTTG
ATGCCTACGCAGAAGTTGTGAGCGCCACAACGGGAGCAGCCAGTATGGACGTCGACTTCGAAGGAGAATTGGAAG
GTTCATCTCTCAAGAATTCTGGTCGCGAGAAGGATCCTCGCGAATGCATCATCGATGTCCGCGAATATGATGTCC
CTTATTACCTTCGCGTTGCTATCGACGTTGAAATTCGCGTGGGACTCTGGTATACAGTTACCTTCAATGAAGGCC
AACCAAGTTTCTCTCAAATGGTTGAGCGTGTCAAACGTGCCGATCCGGTTGTCATGGCCTATGATATAGAAACCA
CCAAGGCTCCCTTGAAATTTCCGGACCAGGCGATTGACCAAGTAATGATGATTTCTTATATGATTGATGGCCAAG
GCTACTTGATAACCAACCGAGAAATTGTCAGCGAAGACATTGATGACTTTGAATATACGCCCAAGGAAGGTTATG
AAGGACCTTTTACGGTCTTCAATGAACGAAACGAAGTGAGATTGTGCATCATCCCATTAGTGTGCTTTGGCTGAT
CTTTCTTATTTCAAGGCTGAAACTATTCGACGCTTCTTTTCTCATATTCAGGAAGTTAAACCGACGGTTATGGCT
ACGTTCAACGGAGACTTTTTCGATTTCCCTTTCTTGGATGCTCGTGCCCAAGTCAATGGTATCGACATGTACCTA
GAGACCGGATTTGCGAAGGACCAAGAAGACGAATACAAGAGTAACAACTGTGCTCACATGGACTGTTTCCGATGG
GTCAAACGTGATTCATACTTGCCTCAAGGAAGTCAAGGCCTAAAAGCCGTTACTACCGCGAAGCTGGGATATAAT
CCAATTGAATTGGATCCGGAACTCATGACGCCGTGAGTACCCAGTGGACGACCTCGAGTGTGACCACTCATGCAG
TTCGTAGTTATGCTATGGAGCAACCCCAAATCTTGGCTCAATATTCCGTTTCCGACGCAGTGGCGACGTACTACC
TGTACATGAAATATGTCCACCCGTTCATCTTCTCCTTGTGCAATATCATTCCTCTCAATCCCGATGAAGTTTTAA
GGAAGGGTAGTGGAACACTATGTGAGACGCTCCTCATGGTACGTTTTTTACTTCGTACGGGAAGACTGCGATATG
CTGATCAGCACGGACTCTAGGTCGAGGCGTTCCGTGGCCACATTATAATGCCAAACAGGCACGAAGAGTCTCATG
GTAACATGCATGAAGGTCATCTTCTTGCTTCTGAGACCTACGTCGGTGGACATGTCGAAGCTCTCGAAGCTGGCG
TATTTCGCAGTGATATCGACACTGATTTCAAGATCGTACCCGCGGCAGTTCAAAAGCTGATTGATGAATTGGACG
CAGCTCTCACATTTTGTATCGTGGAGGAGTCAAAAGCAAATCTCGAAGATGTTACCAACTATGATCAAATCAAAC
AAGAGATTCAAACGGCTCTCGAGGTCATGCGAGATAATCCGAGGCGTACGGATAAACCCCTCATTTATCATTTGG
ATGTCGCTGCTATGTATCCAAACATCATGTTATCCAACCGTCTTCAACCCGATTCCATGGTCGACGAGTCTGTTT
GCGCAGTTTGCGATCATAATCGTCCCGGAAAAACTTGTGATCGTCGATTGAAGTGGGCTTGGAGAGGAGAGTTCT
TCCCTGCTCATCGAGACGAGTTCAATATGATCAAACATGCCCTCAACCAGGAGGATTTTCCTCCCAAGAGACCTG
GAGGTCCCAAACGCAAGTTTGTGGATTTGGCACCTTCGGAGCAGACTGCTCTTCTCCATAAACGTTTAGGGGATT
ATTCGCGCAAGGTGTATGCCAAGACGCGAGAGACAAAAGTCGAACACCGCGAAGCGATTGTATGTCAGAAGGAAA
ATCCTTTTTATGTTGATACTGTGCGACGATTCCGAGATCGACGTTACGAGTATAAAGGTTTACTCAAGAAAGCTA
AGGGTGCTCTTGACTCTGTGCTTGATGAGGGTCGTTCTCTTGCAGAGGTCGATGAAGCCAAGAAAATGATCGTAT
TGTACGATTCTCTGCAGCTCGCTCACAAGTGTATCCTGAATTCCTTTTATGGCTATGTCATGAGGAAGGGTGCTC
GTTGGCATTCGATGGAGATGGCGGGAATTACGTGTTTGACGGGTTCGACTATCATTCAGATGGCGCGTGCTCTGG
TTGAACAGATTGGAAGGCCGTTGGAGTTGGATACGGATGGTATTTGGTGTATGCTTCCTGGAGTGTTTCCTGAAA
ACTTCAAGTTCAAGCTCGCGAACGGGAAGGCAATTGGGTTTTCGTATCCCTGTACCATGCTCAATCATCTGGTCT
ACGCCCAATTCACTAATCATCAGTATCACGACTTTGATCCTGAAACGGGGGAATACAAGGTCCATAGCGAGAACT
CTATCTTCTTCGAGTTGGATGGTCCTTACAAGGCTATGATCTTGCCATCATCCAAGGAAGAGGATAAATTGTTGA
AGAAACGTTACGCGGTTTTCAATGACGACGGTTCGCTTGCGGAGTTGAAGGGATTCGAAGTCAAAAGACGAGGAG
AACTTCAATTGATCAAGATCTTCCAATCTCAACTGTTTGAGAAATTCCTTCTTGGTTCTACTACTCAGGAATGTT
ATGCTTTTGTGGCGCAAATTGCTAATCAATGGCTTGACGTGTTGGATAGTCGAGCAAAAGACTTGACTGATGAAG
AGCTCGTTGAACTTATTGCTGAAAATCGTAGCATGTCAAGGACGCTTGCTGAATATGCTGGTCAGAAGTCGACGT
CTATTAGTACGGCACGGCGTTTGGCAGAGTTTTTGGGAGATCAGATGGTGAAGGATAAAGGATTGGCATGCAAAT
TTATTATTTCTGCGAAACCGTTGGGGGCTCCTGTAACGGAACGTGCTGTTCCAGTTGCAATCTTTTCTGCGGAGG
AGAGTGTGAAGAGGGTGTATTTGAGGAAATGGTTGAAGGATAATGGTCTCATCAATTTCGATTTGAGGTCGATTT
TGGATTGGGAGTATTATATTGAGAGGTTGGGTTCGGTGATTCAGAAGCTTATTACTATTCCTGCGGCGATGCAGA
AGGTGGCTAATCCTGTTCCGAGGATCGCTCATCCGGATTGGTTGCATCGGAGGATTGTGAAGTTGACGGAGAAGT
TCAAGCAGAACAAGATGACGGATTTTTTCGGGAAGAAAGAGTCGAAGGAGGATCAGGAAACTCAGCCGATGGATA
TTGAAGATGCGGGTGGTAGTGAGGGTGCGAAAACTGGGATACAGAAGTTTGCTGTTATCAGGAAGAAGATTCGTG
AAAGGACACCTGAGGTGAAGGAACCGGAAGAGATACCCATACCGAATCCCAATCTACACTATCGCGATTGGATCA
AGGCAATGCGACCACGATGGAGGAAAAGGAGAGAACTACGTAATGGCGATGGTGAAAGTGCTTCTGTTGTTATTC
CGAGCATGTTCAATGGGGCGAAGGTCCGGACGAGGAATCGTTGGGATGTTGTTCAAATTCGACCGACTTCGACAC
CAGGCCGGTTTATACTATGGCTGTCTGTTGGTTCTGAATTGGTGGCGGCGCCCATTCGGATCCCTCGTCAATTTT
ATATCCATATGAAGACACCACGGGAAAACCTATTTTGGCCAGGATATTATCACTACGAGAAGGTTACTCGTAACT
TGCCGCACGAGCTTCCTTGCGACAATCTTTATAAGATTACGGTTCGCGAGGAGACTTATCATGACATCAGGGAAC
ATTTCATTGATCTGACGAATGACCCAAATGTGGATGGCGTATATGAGCAACAGGTGAGAAAACTTAACAGGAGCT
GGAATAAATTCGCCTCTTTAACGTTTATTAGGTTCCTCTGGCTCTTCGGGCAATCATAAAACTTGGGAAAACATG
TTCAGCAGAGGATGCAAGTCTTACATTGAACCGCGCTCAGACTGTTGGCTTCGACCTAGAACAACTGGACAAAGC
AGGTACATCTCGCCAGCCTTGCGTTAGGAGTGAAACCGGAAAGTACATCTTCCTCTACCACGCTTGCTCGGCAAA
CGCTCCTCTCCATGTCTTTACTCTCTTTTTGCCAAACGGATCCGCCAAGCTACATATTGTCGATCCCGCTACACG
TCGTCAAGCCATTCCTCGACTACAAGAACAGTATTCTAGTCAGCTACGACAATTCCGAGAGCAGTATGATGCACC
CAAGTCATATAATTACGTGGAAACCTTGGATATTTCGACCACATATCATAGTAATGATGTGACGGCTCTCAAAGC
GATATCGCGTGAGCTAGGACTGCTCGAAGACAAGTCATTTACAGTCGTCATCTCGTCGAGCAAGGACGACGCGTA
TTTTGAGCAGCAGCTTCCCAAGCTTGCAAAGTTCCCGACGTTGTCTATGCCCAAGGCAAAGGCACCACACACTCT
CGATGTCTTCCCGTGGCAGACTCATGTCGCTGCGAAATTGATGACTCGATATCTCACTATGGGAAGTTGGATCGA
TCGCTTGGTGACACTTGCCGACTATTATGATATTCCGATGGGTCATATTGAAGGAGATCAGCCGCTACACTGTAT
CGATGTCAATTTTGCTCGGAAATTGATTCAACAGGATATCGTTCTTTGGTGGTCTTCTGGCGAACGACCTGACTT
GGGAGGTATCGAGAATGACACGCATTTATCTGAAGATTTTCCCGAAACCGAATTTTCGAGTCCCGGAGTCTACTC
CAATGTCTGCCTCGAGATAACGCTTAGGAATTTGGCAGTAAATAGTGTGCTACAATCTCAGTTGGTTAACGAATT
GGAAGGAAGTGGAGGGTCGACAGCGTTTGATTCTATATCTCATACCCTAAACGAGTACTCGAAAGCGGATGGTCA
GAGGGAATTGACGTTGGCAGAGTCACAGATTTCCTCCCAGACTTTTGGAATTATTCGGTCCCTGGTTAAAGCTTG
GCTCCTTGACAAAGTTCGTAACGACTATGAAAGTCCGGCGGCCCTTGCGGTGGATCATTTTTGGCGATGGGTCAG
CTCGACTACCTCTGGTCTATACGATCCTACAATTCACCGATTCATCCACGGTTTGATGCGCAAAACCTTCATCCA
GCTGATTGCGGAATTCAAGCGCCTTGGCTCAACAGTCGTCTATGCTGACTTTAGCAGTATTTTGTTGGCTACCTC
AAAACCTCCGGGCACTGCATACGCCTATGCGACTTATATTGCCACCGCTGCTACTTCCAATGAACTTTTCCAGCA
TATCTACTTGAACACGGAAAAGTTTTACGATTTCCTCATCTTCATGGACCGGGCAAACATGTCTGCCATCCACTG
TGAAGACCCTTTGGCAACGGAACCATCGAATCACATTTCCCTCGAGATGCGGTGGAACATCCAGCAGTTTTTACC
TCCTGCTATCCATGACGATTTTGCTCAGATCGTTCAATTCTACTTGATTCAACTTTTCAAAATCAAGCAGAAAAG
CAATGCCATTGCAAGAAAACCTTTACGAATCCTCGAGAACGGCGCGCCCGATAATACCCAACGAGATGCTGCGAA
GTCGAGCGAATCCGAATCGATAGTGGAATTCATTGCTCATAAGCTGACCTCAAAAATGTTGAAAACAGTTGGGTC
CATGCAGGAGCGCTATCGTGAGTCTATGATGGATGAGGAAGTTGCCAAAAGCTTCGAATTTCCTACATTGCCGGG
TGGCTATCTTCACTTTGATAACCCTACCTTGGAGTTCATCAAGTCCGTCTGCGAAATTTTTTCCCTTGCCAAAGC
ATATGACGTCGAGATCCGGTTGATGAAGCGAAATCTACTGGAGCTGGTTGGCGTACGGGAATTTGCGATGGAGGC
TGCATTCAAGAACCCCTGCGAACCCCTCAAACTGTCGAATGTACCTTGCTCCCATTGCGATGTCCTTCGCGACTT
CGACTTTTGTAGAGACCCAGATCTGGCTGCAAGTGGACAGTCGGCAACTCCAAAATGGTATTGCTCAAGTTGCAA
CGGAGAATATGACCGAGTAGCCATCGAATTCATGCTGATTGGGGTCGTTCAAGCTATCGAAGCCAGCTTTGCGCA
GCAAGATCTTCGATGTCCCAAGTGCAAACAAATCCGATCAGACAACTTATCTAGACACTGTCAATGCTCAGGATC
TTATCTCTATACATCGAACAAAGTGGATGCACGTCGGAAATTGCGCACTATGGTTAACATCGCTATTTTCTATAA
TTTACCTCGCCTCAAGGTGAGATTGTATCGTCTTTTCTCATGGACTGTCACTAACGGTGTGTCTAGGAATCATCT
CAAATGTTACTCGCAAACTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail