Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|031540
Gene name
Locationscaffold_12:992912..995181
Strand+
Gene length (bp)2269
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08450 SGL SMP-30/Gluconolactonase/LRE-like region 2.9E-26 200 373
PF00177 Ribosomal_S7 Ribosomal protein S7p/S5e 4.7E-24 464 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13744|RT07_SCHPO 37S ribosomal protein S7, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm7 PE=1 SV=2 468 601 2.0E-18
sp|B1LBP4|RS7_THESQ 30S ribosomal protein S7 OS=Thermotoga sp. (strain RQ2) GN=rpsG PE=3 SV=1 450 598 1.0E-13
sp|A5IM79|RS7_THEP1 30S ribosomal protein S7 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsG PE=3 SV=1 450 598 1.0E-13
sp|P38526|RS7_THEMA 30S ribosomal protein S7 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsG PE=1 SV=2 463 598 2.0E-13
sp|B7IHU2|RS7_THEAB 30S ribosomal protein S7 OS=Thermosipho africanus (strain TCF52B) GN=rpsG PE=3 SV=1 464 598 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13744|RT07_SCHPO 37S ribosomal protein S7, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm7 PE=1 SV=2 468 601 2.0E-18
sp|B1LBP4|RS7_THESQ 30S ribosomal protein S7 OS=Thermotoga sp. (strain RQ2) GN=rpsG PE=3 SV=1 450 598 1.0E-13
sp|A5IM79|RS7_THEP1 30S ribosomal protein S7 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsG PE=3 SV=1 450 598 1.0E-13
sp|P38526|RS7_THEMA 30S ribosomal protein S7 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsG PE=1 SV=2 463 598 2.0E-13
sp|B7IHU2|RS7_THEAB 30S ribosomal protein S7 OS=Thermosipho africanus (strain TCF52B) GN=rpsG PE=3 SV=1 464 598 5.0E-13
sp|B2S2J1|RS7_TREPS 30S ribosomal protein S7 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsG PE=3 SV=1 451 598 1.0E-12
sp|O83272|RS7_TREPA 30S ribosomal protein S7 OS=Treponema pallidum (strain Nichols) GN=rpsG PE=3 SV=1 451 598 1.0E-12
sp|A6LLK9|RS7_THEM4 30S ribosomal protein S7 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsG PE=3 SV=1 464 598 3.0E-12
sp|B9K882|RS7_THENN 30S ribosomal protein S7 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsG PE=3 SV=1 463 598 3.0E-12
sp|P47150|RT07_YEAST 37S ribosomal protein S7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM7 PE=1 SV=1 463 598 6.0E-12
sp|Q09FQ1|RR7_NANDO 30S ribosomal protein S7, chloroplastic OS=Nandina domestica GN=rps7-A PE=3 SV=1 451 598 7.0E-12
sp|Q6YXS0|RR7_PHYPA 30S ribosomal protein S7, chloroplastic OS=Physcomitrella patens subsp. patens GN=rps7 PE=3 SV=1 464 598 8.0E-12
sp|Q6KGW1|RR7_SCIVE 30S ribosomal protein S7, chloroplastic OS=Sciadopitys verticillata GN=rps7 PE=3 SV=1 470 598 8.0E-12
sp|Q01578|GNL_ZYMMO Gluconolactonase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gnl PE=1 SV=2 69 356 8.0E-12
sp|Q71T50|RR7_HYDCA 30S ribosomal protein S7, chloroplastic OS=Hydrastis canadensis GN=rps7 PE=3 SV=1 451 598 1.0E-11
sp|B5YDT9|RS7_DICT6 30S ribosomal protein S7 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsG PE=3 SV=1 455 598 3.0E-11
sp|Q6EM77|RR7_PHYAM 30S ribosomal protein S7, chloroplastic OS=Phytolacca americana GN=rps7 PE=3 SV=1 451 598 4.0E-11
sp|B8G6T0|RS7_CHLAD 30S ribosomal protein S7 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsG PE=3 SV=1 463 598 7.0E-11
sp|B4UB96|RS7_ANASK 30S ribosomal protein S7 OS=Anaeromyxobacter sp. (strain K) GN=rpsG PE=3 SV=1 464 598 7.0E-11
sp|B8J857|RS7_ANAD2 30S ribosomal protein S7 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsG PE=3 SV=1 464 598 7.0E-11
sp|Q73NV4|RS7_TREDE 30S ribosomal protein S7 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsG PE=3 SV=1 452 598 8.0E-11
sp|Q20EW1|RR7_OLTVI 30S ribosomal protein S7, chloroplastic OS=Oltmannsiellopsis viridis GN=rps7 PE=3 SV=1 456 598 8.0E-11
sp|Q67IL8|RR7_ANACO 30S ribosomal protein S7, chloroplastic OS=Ananas comosus GN=rps7 PE=3 SV=1 451 597 8.0E-11
sp|B8E1C9|RS7_DICTD 30S ribosomal protein S7 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsG PE=3 SV=1 455 598 8.0E-11
sp|Q160Y2|RS7_ROSDO 30S ribosomal protein S7 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsG PE=3 SV=1 448 598 9.0E-11
sp|A1B022|RS7_PARDP 30S ribosomal protein S7 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsG PE=3 SV=1 448 598 1.0E-10
sp|Q5SCY6|RR7_HUPLU 30S ribosomal protein S7, chloroplastic OS=Huperzia lucidula GN=rps7 PE=3 SV=1 458 598 1.0E-10
sp|P30057|RR7_EPIVI 30S ribosomal protein S7, plastid OS=Epifagus virginiana GN=rps7-A PE=3 SV=1 453 598 1.0E-10
sp|Q85B41|RR7_ANTFO 30S ribosomal protein S7, chloroplastic OS=Anthoceros formosae GN=rps7-A PE=2 SV=1 452 598 1.0E-10
sp|P06360|RR7_MARPO 30S ribosomal protein S7, chloroplastic OS=Marchantia polymorpha GN=rps7 PE=3 SV=1 452 598 1.0E-10
sp|B0UHX3|RS7_METS4 30S ribosomal protein S7 OS=Methylobacterium sp. (strain 4-46) GN=rpsG PE=3 SV=1 448 598 1.0E-10
sp|A8F4Q7|RS7_PSELT 30S ribosomal protein S7 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsG PE=3 SV=1 464 598 1.0E-10
sp|B1ZLK0|RS7_METPB 30S ribosomal protein S7 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsG PE=3 SV=1 448 598 2.0E-10
sp|Q28UW9|RS7_JANSC 30S ribosomal protein S7 OS=Jannaschia sp. (strain CCS1) GN=rpsG PE=3 SV=1 448 598 2.0E-10
sp|Q2IJ92|RS7_ANADE 30S ribosomal protein S7 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsG PE=3 SV=1 464 598 2.0E-10
sp|A0L5W9|RS7_MAGMM 30S ribosomal protein S7 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsG PE=3 SV=1 451 597 2.0E-10
sp|B1VKJ4|RR7_CRYJA 30S ribosomal protein S7, chloroplastic OS=Cryptomeria japonica GN=rps7 PE=3 SV=1 464 598 2.0E-10
sp|Q9GFN5|RR7_ACOCL 30S ribosomal protein S7, chloroplastic OS=Acorus calamus GN=rps7-A PE=3 SV=1 451 598 2.0E-10
sp|A9LYE6|RR7_ACOAM 30S ribosomal protein S7, chloroplastic OS=Acorus americanus GN=rps7-A PE=3 SV=1 451 598 2.0E-10
sp|A7HBL5|RS7_ANADF 30S ribosomal protein S7 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsG PE=3 SV=1 464 598 3.0E-10
sp|A9ETC1|RS7_SORC5 30S ribosomal protein S7 OS=Sorangium cellulosum (strain So ce56) GN=rpsG PE=3 SV=1 464 598 3.0E-10
sp|Q32RW0|RR7_STAPU 30S ribosomal protein S7, chloroplastic OS=Staurastrum punctulatum GN=rps7 PE=3 SV=1 464 598 3.0E-10
sp|O21240|RT07_RECAM Ribosomal protein S7, mitochondrial OS=Reclinomonas americana GN=RPS7 PE=3 SV=1 464 598 3.0E-10
sp|B8IS81|RS7_METNO 30S ribosomal protein S7 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsG PE=3 SV=1 448 598 4.0E-10
sp|P59061|RS7_RHOCA 30S ribosomal protein S7 OS=Rhodobacter capsulatus GN=rpsG PE=3 SV=1 448 598 4.0E-10
sp|B8ELG7|RS7_METSB 30S ribosomal protein S7 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsG PE=3 SV=1 463 598 5.0E-10
sp|Q71L16|RR7_CEDDE 30S ribosomal protein S7, chloroplastic OS=Cedrus deodara GN=rps7 PE=3 SV=1 451 592 5.0E-10
sp|A9W4P7|RS7_METEP 30S ribosomal protein S7 OS=Methylobacterium extorquens (strain PA1) GN=rpsG PE=3 SV=1 448 598 5.0E-10
sp|B7L0Q7|RS7_METC4 30S ribosomal protein S7 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsG PE=3 SV=1 448 598 5.0E-10
sp|A9L9E1|RR7_LEMMI 30S ribosomal protein S7, chloroplastic OS=Lemna minor GN=rps7-A PE=3 SV=1 451 598 6.0E-10
sp|Q6B8X9|RR7_GRATL 30S ribosomal protein S7, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rps7 PE=3 SV=1 464 598 6.0E-10
sp|Q06J33|RR7_BIGNA 30S ribosomal protein S7, chloroplastic OS=Bigelowiella natans GN=rps7 PE=3 SV=1 464 597 6.0E-10
sp|B1LWS2|RS7_METRJ 30S ribosomal protein S7 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsG PE=3 SV=1 448 598 7.0E-10
sp|B3EUF4|RS7_AMOA5 30S ribosomal protein S7 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsG PE=3 SV=1 452 598 7.0E-10
sp|Q2JUX6|RS7_SYNJA 30S ribosomal protein S7 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsG PE=3 SV=1 451 598 7.0E-10
sp|O63057|RR7_LATCL 30S ribosomal protein S7, plastid OS=Lathraea clandestina GN=rps7 PE=3 SV=1 451 598 7.0E-10
sp|Q3BAH4|RR7_PHAAO 30S ribosomal protein S7, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=rps7-A PE=3 SV=1 451 597 7.0E-10
sp|B5ELX5|RS7_ACIF5 30S ribosomal protein S7 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsG PE=3 SV=1 464 598 8.0E-10
sp|B7J463|RS7_ACIF2 30S ribosomal protein S7 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsG PE=3 SV=1 464 598 8.0E-10
sp|C1CXH1|RS7_DEIDV 30S ribosomal protein S7 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsG PE=3 SV=1 467 598 8.0E-10
sp|Q3ZJ48|RR7_PSEAK 30S ribosomal protein S7, chloroplastic OS=Pseudendoclonium akinetum GN=rps7 PE=3 SV=1 470 598 8.0E-10
sp|Q9TJQ9|RR7_PROWI 30S ribosomal protein S7, plastid OS=Prototheca wickerhamii GN=rps7 PE=3 SV=1 464 598 9.0E-10
sp|B2Y203|RR7_WELMI 30S ribosomal protein S7, chloroplastic OS=Welwitschia mirabilis GN=rps7 PE=3 SV=1 452 598 9.0E-10
sp|Q1IX67|RS7_DEIGD 30S ribosomal protein S7 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsG PE=3 SV=1 467 598 9.0E-10
sp|Q6KGW4|RR7_SCHCH 30S ribosomal protein S7, chloroplastic OS=Schisandra chinensis GN=rps7 PE=3 SV=1 451 597 9.0E-10
sp|A8LM44|RS7_DINSH 30S ribosomal protein S7 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsG PE=3 SV=1 448 598 9.0E-10
sp|Q67II8|RR7_TYPAN 30S ribosomal protein S7, chloroplastic OS=Typha angustifolia GN=rps7 PE=3 SV=1 451 597 1.0E-09
sp|Q6EM84|RR7_NELLU 30S ribosomal protein S7, chloroplastic OS=Nelumbo lutea GN=rps7 PE=3 SV=1 451 597 1.0E-09
sp|P59063|RR7_CHAGL 30S ribosomal protein S7, chloroplastic OS=Chaetosphaeridium globosum GN=rps7 PE=3 SV=1 464 598 1.0E-09
sp|C5CGR8|RS7_KOSOT 30S ribosomal protein S7 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsG PE=3 SV=1 464 593 1.0E-09
sp|A4QJX6|RR7_OLIPU 30S ribosomal protein S7, chloroplastic OS=Olimarabidopsis pumila GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QLX9|RR7_NASOF 30S ribosomal protein S7, chloroplastic OS=Nasturtium officinale GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QLP0|RR7_LOBMA 30S ribosomal protein S7, chloroplastic OS=Lobularia maritima GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QLF2|RR7_LEPVR 30S ribosomal protein S7, chloroplastic OS=Lepidium virginicum GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|Q2L964|RR7_GOSHI 30S ribosomal protein S7, chloroplastic OS=Gossypium hirsutum GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A0ZZ80|RR7_GOSBA 30S ribosomal protein S7, chloroplastic OS=Gossypium barbadense GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QL65|RR7_DRANE 30S ribosomal protein S7, chloroplastic OS=Draba nemorosa GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QKX7|RR7_CRUWA 30S ribosomal protein S7, chloroplastic OS=Crucihimalaya wallichii GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|B1A980|RR7_CARPA 30S ribosomal protein S7, chloroplastic OS=Carica papaya GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QKN8|RR7_CAPBU 30S ribosomal protein S7, chloroplastic OS=Capsella bursa-pastoris GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|P61842|RR7_BRANA 30S ribosomal protein S7, chloroplastic OS=Brassica napus GN=rps7 PE=3 SV=1 451 597 1.0E-09
sp|A4QKF1|RR7_BARVE 30S ribosomal protein S7, chloroplastic OS=Barbarea verna GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|P61841|RR7_ARATH 30S ribosomal protein S7, chloroplastic OS=Arabidopsis thaliana GN=rps7-A PE=1 SV=1 451 597 1.0E-09
sp|A4QK64|RR7_ARAHI 30S ribosomal protein S7, chloroplastic OS=Arabis hirsuta GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QJP4|RR7_AETGR 30S ribosomal protein S7, chloroplastic OS=Aethionema grandiflorum GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|A4QJG0|RR7_AETCO 30S ribosomal protein S7, chloroplastic OS=Aethionema cordifolium GN=rps7-A PE=3 SV=1 451 597 1.0E-09
sp|Q06FM0|RR7_PELHO 30S ribosomal protein S7, chloroplastic OS=Pelargonium hortorum GN=rps7-A PE=3 SV=1 455 597 1.0E-09
sp|Q85WV2|RR7_PINKO 30S ribosomal protein S7, chloroplastic OS=Pinus koraiensis GN=rps7 PE=3 SV=1 451 598 1.0E-09
sp|Q71L24|RR7_METGY 30S ribosomal protein S7, chloroplastic OS=Metasequoia glyptostroboides GN=rps7 PE=3 SV=1 464 598 1.0E-09
sp|A0T0Z9|RR7_THAPS 30S ribosomal protein S7, chloroplastic OS=Thalassiosira pseudonana GN=rps7 PE=3 SV=1 465 598 1.0E-09
sp|Q6EMB0|RR7_ARIMA 30S ribosomal protein S7, chloroplastic OS=Aristolochia macrophylla GN=rps7 PE=3 SV=1 451 597 1.0E-09
sp|Q2JMX9|RS7_SYNJB 30S ribosomal protein S7 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsG PE=3 SV=1 451 598 1.0E-09
sp|Q1WVA1|RS7_LACS1 30S ribosomal protein S7 OS=Lactobacillus salivarius (strain UCC118) GN=rpsG PE=3 SV=1 464 598 2.0E-09
sp|Q6EM56|RR7_STEPS 30S ribosomal protein S7, chloroplastic OS=Stewartia pseudocamellia GN=rps7 PE=3 SV=1 451 598 2.0E-09
sp|P62732|RR7_TOBAC 30S ribosomal protein S7, chloroplastic OS=Nicotiana tabacum GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|Q27RZ0|RR7_SOLTU 30S ribosomal protein S7, chloroplastic OS=Solanum tuberosum GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|P62731|RR7_SOLNI 30S ribosomal protein S7, chloroplastic OS=Solanum nigrum GN=rps7 PE=3 SV=1 451 598 2.0E-09
sp|Q2MI54|RR7_SOLLC 30S ribosomal protein S7, chloroplastic OS=Solanum lycopersicum GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|Q2MIE1|RR7_SOLBU 30S ribosomal protein S7, chloroplastic OS=Solanum bulbocastanum GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|Q33BY2|RR7_NICTO 30S ribosomal protein S7, chloroplastic OS=Nicotiana tomentosiformis GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|Q3C1M8|RR7_NICSY 30S ribosomal protein S7, chloroplastic OS=Nicotiana sylvestris GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|P62729|RR7_ATRBE 30S ribosomal protein S7, chloroplastic OS=Atropa belladonna GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|Q1GK43|RS7_RUEST 30S ribosomal protein S7 OS=Ruegeria sp. (strain TM1040) GN=rpsG PE=3 SV=1 448 598 2.0E-09
sp|P17291|RS7_THET8 30S ribosomal protein S7 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsG PE=1 SV=3 450 598 2.0E-09
sp|P62667|RS7_THET2 30S ribosomal protein S7 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsG PE=1 SV=2 450 598 2.0E-09
sp|B1MW22|RS7_LEUCK 30S ribosomal protein S7 OS=Leuconostoc citreum (strain KM20) GN=rpsG PE=3 SV=1 452 598 2.0E-09
sp|Q9GFM3|RR7_CERDE 30S ribosomal protein S7, chloroplastic OS=Ceratophyllum demersum GN=rps7-A PE=3 SV=1 451 597 2.0E-09
sp|Q5NQ67|RS7_ZYMMO 30S ribosomal protein S7 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsG PE=3 SV=1 449 598 2.0E-09
sp|Q6KGV8|RR7_SPAWA 30S ribosomal protein S7, chloroplastic OS=Spathiphyllum wallisii GN=rps7 PE=3 SV=1 451 597 2.0E-09
sp|B3WAM3|RS7_LACCB 30S ribosomal protein S7 OS=Lactobacillus casei (strain BL23) GN=rpsG PE=3 SV=1 464 598 2.0E-09
sp|Q034X7|RS7_LACC3 30S ribosomal protein S7 OS=Lactobacillus casei (strain ATCC 334) GN=rpsG PE=3 SV=1 464 598 2.0E-09
sp|Q0ABH9|RS7_ALKEH 30S ribosomal protein S7 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsG PE=3 SV=1 464 598 2.0E-09
sp|Q9GFM6|RR7_CALFL 30S ribosomal protein S7, chloroplastic OS=Calycanthus floridus GN=rps7 PE=3 SV=1 451 598 2.0E-09
sp|Q7HKW9|RR7_CALFG 30S ribosomal protein S7, chloroplastic OS=Calycanthus floridus var. glaucus GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|A7IFX7|RS7_XANP2 30S ribosomal protein S7 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsG PE=3 SV=1 448 598 2.0E-09
sp|Q6AP75|RS7_DESPS 30S ribosomal protein S7 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsG PE=3 SV=1 456 598 2.0E-09
sp|Q9B1A1|RR7_LOTJA 30S ribosomal protein S7, chloroplastic OS=Lotus japonicus GN=rps7-A PE=3 SV=1 451 597 2.0E-09
sp|Q68RU7|RR7_PANGI 30S ribosomal protein S7, chloroplastic OS=Panax ginseng GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|Q0G9Q3|RR7_DAUCA 30S ribosomal protein S7, chloroplastic OS=Daucus carota GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|B9KZZ1|RS7_THERP 30S ribosomal protein S7 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpsG PE=3 SV=1 462 598 2.0E-09
sp|Q9GFK3|RR7_SAUCE 30S ribosomal protein S7, chloroplastic OS=Saururus cernuus GN=rps7 PE=3 SV=1 451 598 2.0E-09
sp|P42342|RR7_SPIMX 30S ribosomal protein S7, chloroplastic OS=Spirogyra maxima GN=rps7 PE=3 SV=1 464 598 2.0E-09
sp|Q09MB7|RR7_CITSI 30S ribosomal protein S7, chloroplastic OS=Citrus sinensis GN=rps7-A PE=3 SV=1 451 597 2.0E-09
sp|Q9GFN2|RR7_ASACA 30S ribosomal protein S7, chloroplastic OS=Asarum canadense GN=rps7 PE=3 SV=1 451 597 2.0E-09
sp|Q06GK0|RR7_PIPCE 30S ribosomal protein S7, chloroplastic OS=Piper cenocladum GN=rps7-A PE=3 SV=1 451 598 2.0E-09
sp|B1NWJ5|RR7_MANES 30S ribosomal protein S7, chloroplastic OS=Manihot esculenta GN=rps7-A PE=3 SV=1 451 597 2.0E-09
sp|Q49KT8|RR7_EUCGG 30S ribosomal protein S7, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rps7-A PE=3 SV=1 451 597 2.0E-09
sp|A6MMQ4|RR7_DIOEL 30S ribosomal protein S7, chloroplastic OS=Dioscorea elephantipes GN=rps7-A PE=3 SV=1 451 597 2.0E-09
sp|Q9GFL8|RR7_DIOBU 30S ribosomal protein S7, chloroplastic OS=Dioscorea bulbifera GN=rps7 PE=3 SV=1 451 597 2.0E-09
sp|Q67IP2|RR7_BUTUM 30S ribosomal protein S7, chloroplastic OS=Butomus umbellatus GN=rps7 PE=3 SV=1 451 597 2.0E-09
sp|Q01W88|RS7_SOLUE 30S ribosomal protein S7 OS=Solibacter usitatus (strain Ellin6076) GN=rpsG PE=3 SV=1 470 598 2.0E-09
sp|Q6EM99|RR7_EUOAL 30S ribosomal protein S7, chloroplastic OS=Euonymus alatus GN=rps7 PE=3 SV=1 451 597 2.0E-09
sp|Q6EMA2|RR7_CORMA 30S ribosomal protein S7, chloroplastic OS=Cornus mas GN=rps7 PE=3 SV=1 451 598 3.0E-09
sp|Q332R9|RR7_LACSA 30S ribosomal protein S7, chloroplastic OS=Lactuca sativa GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|Q5LMR3|RS7_RUEPO 30S ribosomal protein S7 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsG PE=3 SV=1 448 598 3.0E-09
sp|A0A381|RR7_COFAR 30S ribosomal protein S7, chloroplastic OS=Coffea arabica GN=rps7 PE=3 SV=1 464 598 3.0E-09
sp|Q9GFM9|RR7_CABCA 30S ribosomal protein S7, chloroplastic OS=Cabomba caroliniana GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|Q6EM62|RR7_SARHE 30S ribosomal protein S7, chloroplastic OS=Saruma henryi GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|Q9GE26|RR7_AMBTC 30S ribosomal protein S7, chloroplastic OS=Amborella trichopoda GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|A4GGF5|RR7_PHAVU 30S ribosomal protein S7, chloroplastic OS=Phaseolus vulgaris GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|Q6EM90|RR7_HOUCO 30S ribosomal protein S7, chloroplastic OS=Houttuynia cordata GN=rps7 PE=3 SV=1 451 598 3.0E-09
sp|B2KEM8|RS7_ELUMP 30S ribosomal protein S7 OS=Elusimicrobium minutum (strain Pei191) GN=rpsG PE=3 SV=1 445 598 3.0E-09
sp|Q11HP8|RS7_CHESB 30S ribosomal protein S7 OS=Chelativorans sp. (strain BNC1) GN=rpsG PE=3 SV=1 448 598 3.0E-09
sp|Q67IC5|RR7_ASPOF 30S ribosomal protein S7, chloroplastic OS=Asparagus officinalis GN=rps7 PE=3 SV=1 451 598 3.0E-09
sp|Q67IE0|RR7_SISMO 30S ribosomal protein S7, chloroplastic OS=Sisyrinchium montanum GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|Q6EM68|RR7_PLAOC 30S ribosomal protein S7, chloroplastic OS=Platanus occidentalis GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|Q67IE3|RR7_PHOTN 30S ribosomal protein S7, chloroplastic OS=Phormium tenax GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|Q67IB6|RR7_MAIRA 30S ribosomal protein S7, chloroplastic OS=Maianthemum racemosum GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|P69666|RR7_LIRTU 30S ribosomal protein S7, chloroplastic OS=Liriodendron tulipifera GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|Q67IB0|RR7_LEOCS 30S ribosomal protein S7, chloroplastic OS=Leopoldia comosa GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|P69665|RR7_ILLPA 30S ribosomal protein S7, chloroplastic OS=Illicium parviflorum GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|A6MMZ0|RR7_ILLOL 30S ribosomal protein S7, chloroplastic OS=Illicium oligandrum GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|P69664|RR7_DRIWI 30S ribosomal protein S7, chloroplastic OS=Drimys winteri GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|Q06GT7|RR7_DRIGR 30S ribosomal protein S7, chloroplastic OS=Drimys granadensis GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|P69663|RR7_CERJA 30S ribosomal protein S7, chloroplastic OS=Cercidiphyllum japonicum GN=rps7 PE=3 SV=1 451 597 3.0E-09
sp|A6MM82|RR7_BUXMI 30S ribosomal protein S7, chloroplastic OS=Buxus microphylla GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|A8IAT5|RS7_AZOC5 30S ribosomal protein S7 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsG PE=3 SV=1 448 598 3.0E-09
sp|Q1KXP8|RR7_HELAN 30S ribosomal protein S7, chloroplastic OS=Helianthus annuus GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|B2LMN9|RR7_GUIAB 30S ribosomal protein S7, chloroplastic OS=Guizotia abyssinica GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|P07135|RR7_SOYBN 30S ribosomal protein S7, chloroplastic OS=Glycine max GN=rps7-A PE=3 SV=1 451 597 3.0E-09
sp|Q9MSP1|RR7_NYMOD 30S ribosomal protein S7, chloroplastic OS=Nymphaea odorata GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q6EVZ0|RR7_NYMAL 30S ribosomal protein S7, chloroplastic OS=Nymphaea alba GN=rps7-A PE=3 SV=1 451 597 4.0E-09
sp|Q6EM87|RR7_HYDMC 30S ribosomal protein S7, chloroplastic OS=Hydrangea macrophylla GN=rps7 PE=3 SV=1 451 598 4.0E-09
sp|Q9GFK0|RR7_TROAR 30S ribosomal protein S7, chloroplastic OS=Trochodendron aralioides GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q6KGX9|RR7_LILSU 30S ribosomal protein S7, chloroplastic OS=Lilium superbum GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q67IA4|RR7_YUCGL 30S ribosomal protein S7, chloroplastic OS=Yucca glauca GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q6KGX6|RR7_MAGST 30S ribosomal protein S7, chloroplastic OS=Magnolia stellata GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q0ZIV9|RR7_VITVI 30S ribosomal protein S7, chloroplastic OS=Vitis vinifera GN=rps7-A PE=3 SV=1 451 597 4.0E-09
sp|Q67ID1|RR7_ALLTE 30S ribosomal protein S7, chloroplastic OS=Allium textile GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q67IG9|RR7_COECR 30S ribosomal protein S7, chloroplastic OS=Coelogyne cristata GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|B2G8Y1|RS7_LACRJ 30S ribosomal protein S7 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsG PE=3 SV=1 464 598 4.0E-09
sp|A5VLK9|RS7_LACRD 30S ribosomal protein S7 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsG PE=3 SV=1 464 598 4.0E-09
sp|Q7MA54|RS7_WOLSU 30S ribosomal protein S7 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsG PE=3 SV=1 474 598 4.0E-09
sp|Q6EMA4|RR7_CANWI 30S ribosomal protein S7, chloroplastic OS=Canella winterana GN=rps7 PE=3 SV=1 451 597 4.0E-09
sp|Q6MER7|RS7_PARUW 30S ribosomal protein S7 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsG PE=3 SV=1 464 598 5.0E-09
sp|Q9RXK6|RS7_DEIRA 30S ribosomal protein S7 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsG PE=3 SV=1 467 598 5.0E-09
sp|Q4VZK9|RR7_CUCSA 30S ribosomal protein S7, chloroplastic OS=Cucumis sativus GN=rps7-A PE=3 SV=1 464 597 5.0E-09
sp|A9BHA9|RS7_PETMO 30S ribosomal protein S7 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsG PE=3 SV=1 452 598 5.0E-09
sp|Q09WV9|RR7_MORIN 30S ribosomal protein S7, chloroplastic OS=Morus indica GN=rps7-A PE=3 SV=1 451 597 6.0E-09
sp|P34832|RR7_CUSRE 30S ribosomal protein S7, plastid OS=Cuscuta reflexa GN=rps7-A PE=3 SV=1 451 598 6.0E-09
sp|P56355|RR7_CHLVU 30S ribosomal protein S7, chloroplastic OS=Chlorella vulgaris GN=rps7 PE=3 SV=1 455 598 6.0E-09
sp|Q03ZQ3|RS7_LEUMM 30S ribosomal protein S7 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsG PE=3 SV=1 452 598 6.0E-09
sp|Q7NEF3|RS7_GLOVI 30S ribosomal protein S7 OS=Gloeobacter violaceus (strain PCC 7421) GN=rpsG PE=3 SV=1 464 598 6.0E-09
sp|Q85AI6|RR7_ADICA 30S ribosomal protein S7, chloroplastic OS=Adiantum capillus-veneris GN=rps7-A PE=2 SV=3 464 598 7.0E-09
sp|B9LJC7|RS7_CHLSY 30S ribosomal protein S7 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsG PE=3 SV=1 470 598 7.0E-09
sp|A9WH61|RS7_CHLAA 30S ribosomal protein S7 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsG PE=3 SV=1 470 598 7.0E-09
sp|Q2W2I7|RS7_MAGSA 30S ribosomal protein S7 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsG PE=3 SV=1 448 598 7.0E-09
sp|A8W3G4|RR7_CUSEX 30S ribosomal protein S7, plastid OS=Cuscuta exaltata GN=rps7-A PE=3 SV=1 464 598 7.0E-09
sp|Q6KGY2|RR7_GUNCH 30S ribosomal protein S7, chloroplastic OS=Gunnera chilensis GN=rps7 PE=3 SV=1 451 596 7.0E-09
sp|Q1AU25|RS7_RUBXD 30S ribosomal protein S7 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsG PE=3 SV=1 463 598 7.0E-09
sp|A4IZT7|RS7_FRATW 30S ribosomal protein S7 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|Q5NHX1|RS7_FRATT 30S ribosomal protein S7 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|A0Q4I0|RS7_FRATN 30S ribosomal protein S7 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|B2SDY8|RS7_FRATM 30S ribosomal protein S7 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|Q2A5H3|RS7_FRATH 30S ribosomal protein S7 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|A7N9S3|RS7_FRATF 30S ribosomal protein S7 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|Q14JC3|RS7_FRAT1 30S ribosomal protein S7 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsG PE=3 SV=1 451 598 8.0E-09
sp|Q88XY9|RS7_LACPL 30S ribosomal protein S7 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsG PE=3 SV=1 464 598 8.0E-09
sp|Q1ACP2|RR7_CHAVU 30S ribosomal protein S7, chloroplastic OS=Chara vulgaris GN=rps7 PE=3 SV=1 452 598 8.0E-09
sp|Q98N60|RS7_RHILO 30S ribosomal protein S7 OS=Rhizobium loti (strain MAFF303099) GN=rpsG PE=3 SV=1 448 598 9.0E-09
sp|Q32RP7|RR7_ZYGCR 30S ribosomal protein S7, chloroplastic OS=Zygnema circumcarinatum GN=rps7 PE=3 SV=1 464 598 1.0E-08
sp|Q0BUQ3|RS7_GRABC 30S ribosomal protein S7 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsG PE=3 SV=1 464 598 1.0E-08
sp|Q589A4|RR7_SILLA 30S ribosomal protein S7, chloroplastic OS=Silene latifolia GN=rps7 PE=3 SV=1 451 597 1.0E-08
sp|A2T378|RR7_ANGEV 30S ribosomal protein S7, chloroplastic OS=Angiopteris evecta GN=rps7-A PE=3 SV=1 464 598 1.0E-08
sp|Q1D778|RS7_MYXXD 30S ribosomal protein S7 OS=Myxococcus xanthus (strain DK 1622) GN=rpsG PE=3 SV=1 464 598 1.0E-08
sp|Q9TM55|RR7_BETVU 30S ribosomal protein S7, chloroplastic OS=Beta vulgaris GN=rps7 PE=3 SV=1 451 597 1.0E-08
sp|Q03EB3|RS7_PEDPA 30S ribosomal protein S7 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsG PE=3 SV=1 449 598 1.0E-08
sp|A6MMG8|RR7_CHLSC 30S ribosomal protein S7, chloroplastic OS=Chloranthus spicatus GN=rps7-A PE=3 SV=1 451 597 1.0E-08
sp|Q9GFK8|RR7_LACFR 30S ribosomal protein S7, chloroplastic OS=Lactoris fernandeziana GN=rps7 PE=3 SV=1 451 598 1.0E-08
sp|A5FZW8|RS7_ACICJ 30S ribosomal protein S7 OS=Acidiphilium cryptum (strain JF-5) GN=rpsG PE=3 SV=1 448 598 2.0E-08
sp|P82129|RR7_SPIOL 30S ribosomal protein S7, chloroplastic OS=Spinacia oleracea GN=rps7-A PE=1 SV=3 451 597 2.0E-08
sp|Q04C18|RS7_LACDB 30S ribosomal protein S7 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|Q1GBM1|RS7_LACDA 30S ribosomal protein S7 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|P41652|RR7_PINTH 30S ribosomal protein S7, chloroplastic OS=Pinus thunbergii GN=rps7 PE=3 SV=1 451 598 2.0E-08
sp|B1JDW8|RS7_PSEPW 30S ribosomal protein S7 OS=Pseudomonas putida (strain W619) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|Q88QN9|RS7_PSEPK 30S ribosomal protein S7 OS=Pseudomonas putida (strain KT2440) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|B0KK63|RS7_PSEPG 30S ribosomal protein S7 OS=Pseudomonas putida (strain GB-1) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|A5VXP3|RS7_PSEP1 30S ribosomal protein S7 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|A4XZ94|RS7_PSEMY 30S ribosomal protein S7 OS=Pseudomonas mendocina (strain ymp) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|Q1IFX0|RS7_PSEE4 30S ribosomal protein S7 OS=Pseudomonas entomophila (strain L48) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|Q0BNT0|RS7_FRATO 30S ribosomal protein S7 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsG PE=3 SV=1 451 598 2.0E-08
sp|A5V606|RS7_SPHWW 30S ribosomal protein S7 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsG PE=3 SV=1 449 598 2.0E-08
sp|A6BM55|RR7_GNEPA 30S ribosomal protein S7, chloroplastic OS=Gnetum parvifolium GN=rps7-A PE=3 SV=1 455 598 2.0E-08
sp|Q8YP61|RS7_NOSS1 30S ribosomal protein S7 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsG PE=3 SV=1 457 598 2.0E-08
sp|Q3MDM3|RS7_ANAVT 30S ribosomal protein S7 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsG PE=3 SV=1 457 598 2.0E-08
sp|Q9HWD1|RS7_PSEAE 30S ribosomal protein S7 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|Q02T84|RS7_PSEAB 30S ribosomal protein S7 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|B7V640|RS7_PSEA8 30S ribosomal protein S7 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|A6UZI4|RS7_PSEA7 30S ribosomal protein S7 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsG PE=3 SV=1 464 598 2.0E-08
sp|Q9TKZ6|RR7_NEPOL 30S ribosomal protein S7, chloroplastic OS=Nephroselmis olivacea GN=rps7 PE=3 SV=1 452 598 2.0E-08
sp|A4VHM6|RS7_PSEU5 30S ribosomal protein S7 OS=Pseudomonas stutzeri (strain A1501) GN=rpsG PE=3 SV=1 470 598 3.0E-08
sp|Q02VK9|RS7_LACLS 30S ribosomal protein S7 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsG PE=3 SV=1 452 598 3.0E-08
sp|A2RP73|RS7_LACLM 30S ribosomal protein S7 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsG PE=3 SV=1 452 598 3.0E-08
sp|Q9CDG0|RS7_LACLA 30S ribosomal protein S7 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsG PE=3 SV=1 452 598 3.0E-08
sp|B1ZNF1|RS7_OPITP 30S ribosomal protein S7 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsG PE=3 SV=1 448 598 3.0E-08
sp|Q71L19|RR7_STAER 30S ribosomal protein S7, chloroplastic OS=Stangeria eriopus GN=rps7 PE=3 SV=1 464 598 3.0E-08
sp|B0U0Z2|RS7_FRAP2 30S ribosomal protein S7 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpsG PE=3 SV=1 451 598 3.0E-08
sp|A1E9W9|RR7_SORBI 30S ribosomal protein S7, chloroplastic OS=Sorghum bicolor GN=rps7-A PE=3 SV=1 451 598 3.0E-08
sp|Q6ENQ9|RR7_SACOF 30S ribosomal protein S7, chloroplastic OS=Saccharum officinarum GN=rps7-A PE=3 SV=1 451 598 3.0E-08
sp|Q6L3C6|RR7_SACHY 30S ribosomal protein S7, chloroplastic OS=Saccharum hybrid GN=rps7-A PE=3 SV=1 451 598 3.0E-08
sp|P12339|RR7_MAIZE 30S ribosomal protein S7, chloroplastic OS=Zea mays GN=rps7-A PE=3 SV=2 451 598 3.0E-08
sp|A8Y9D1|RR7_LOLPR 30S ribosomal protein S7, chloroplastic OS=Lolium perenne GN=rps7-A PE=3 SV=1 451 598 3.0E-08
sp|A1E9N5|RR7_HORVU 30S ribosomal protein S7, chloroplastic OS=Hordeum vulgare GN=rps7-A PE=3 SV=1 451 598 3.0E-08
sp|A1EA53|RR7_AGRST 30S ribosomal protein S7, chloroplastic OS=Agrostis stolonifera GN=rps7-A PE=3 SV=1 451 598 3.0E-08
sp|Q134S5|RS7_RHOPS 30S ribosomal protein S7 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsG PE=3 SV=1 474 598 3.0E-08
sp|Q8YHP4|RS7_BRUME 30S ribosomal protein S7 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsG PE=3 SV=1 448 598 3.0E-08
sp|Q4FLL5|RS7_PELUB 30S ribosomal protein S7 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsG PE=3 SV=1 443 598 3.0E-08
sp|B9KL87|RS7_RHOSK 30S ribosomal protein S7 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsG PE=3 SV=1 463 598 3.0E-08
sp|A4WVL2|RS7_RHOS5 30S ribosomal protein S7 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsG PE=3 SV=1 463 598 3.0E-08
sp|Q3J5S6|RS7_RHOS4 30S ribosomal protein S7 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsG PE=3 SV=1 463 598 3.0E-08
sp|A3PGJ3|RS7_RHOS1 30S ribosomal protein S7 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsG1 PE=3 SV=1 463 598 3.0E-08
sp|Q9MUP1|RR7_MESVI 30S ribosomal protein S7, chloroplastic OS=Mesostigma viride GN=rps7 PE=3 SV=1 453 598 3.0E-08
sp|Q38UQ8|RS7_LACSS 30S ribosomal protein S7 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsG PE=3 SV=1 464 598 3.0E-08
sp|Q5FM93|RS7_LACAC 30S ribosomal protein S7 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsG PE=3 SV=1 464 598 4.0E-08
sp|A4GYV8|RR7_POPTR 30S ribosomal protein S7, chloroplastic OS=Populus trichocarpa GN=rps7-A PE=3 SV=1 451 597 4.0E-08
sp|Q14F99|RR7_POPAL 30S ribosomal protein S7, chloroplastic OS=Populus alba GN=rps7-A PE=3 SV=1 451 597 4.0E-08
sp|A8YXK2|RS7_LACH4 30S ribosomal protein S7 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsG PE=3 SV=1 464 598 4.0E-08
sp|Q8G074|RS7_BRUSU 30S ribosomal protein S7 OS=Brucella suis biovar 1 (strain 1330) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|B0CH36|RS7_BRUSI 30S ribosomal protein S7 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|A5VR10|RS7_BRUO2 30S ribosomal protein S7 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|C0RJK5|RS7_BRUMB 30S ribosomal protein S7 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|A9M5Q4|RS7_BRUC2 30S ribosomal protein S7 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|Q57CQ4|RS7_BRUAB 30S ribosomal protein S7 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|Q2YLZ9|RS7_BRUA2 30S ribosomal protein S7 OS=Brucella abortus (strain 2308) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|B2S683|RS7_BRUA1 30S ribosomal protein S7 OS=Brucella abortus (strain S19) GN=rpsG PE=3 SV=1 448 598 4.0E-08
sp|B5YG51|RS7_THEYD 30S ribosomal protein S7 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsG PE=3 SV=1 464 598 4.0E-08
sp|Q6KGX3|RR7_PEA 30S ribosomal protein S7, chloroplastic OS=Pisum sativum GN=rps7 PE=3 SV=1 464 597 4.0E-08
sp|C1DKK8|RS7_AZOVD 30S ribosomal protein S7 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsG PE=3 SV=1 464 598 4.0E-08
sp|A7HM56|RS7_FERNB 30S ribosomal protein S7 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsG PE=3 SV=1 464 598 4.0E-08
sp|B9JVN3|RS7_AGRVS 30S ribosomal protein S7 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsG PE=3 SV=1 448 598 5.0E-08
sp|B0JSE2|RS7_MICAN 30S ribosomal protein S7 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsG PE=3 SV=1 463 598 6.0E-08
sp|Q71L39|RR7_BOWSE 30S ribosomal protein S7, chloroplastic OS=Bowenia serrulata GN=rps7 PE=3 SV=1 452 598 6.0E-08
sp|Q03IS0|RS7_STRTD 30S ribosomal protein S7 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsG PE=3 SV=1 451 598 6.0E-08
sp|Q5M2M5|RS7_STRT2 30S ribosomal protein S7 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsG PE=3 SV=1 451 598 6.0E-08
sp|Q5LY20|RS7_STRT1 30S ribosomal protein S7 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsG PE=3 SV=1 451 598 6.0E-08
sp|Q9TLV7|RR7_CYACA 30S ribosomal protein S7, chloroplastic OS=Cyanidium caldarium GN=rps7 PE=3 SV=1 464 598 6.0E-08
sp|Q6MJ12|RS7_BDEBA 30S ribosomal protein S7 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsG PE=3 SV=1 464 598 6.0E-08
sp|C3K2Y0|RS7_PSEFS 30S ribosomal protein S7 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsG PE=3 SV=1 464 598 6.0E-08
sp|Q4K529|RS7_PSEF5 30S ribosomal protein S7 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsG PE=3 SV=1 464 598 6.0E-08
sp|Q48D32|RS7_PSE14 30S ribosomal protein S7 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsG PE=3 SV=1 464 598 6.0E-08
sp|B3PK33|RS7_CELJU 30S ribosomal protein S7 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsG PE=3 SV=1 464 598 6.0E-08
sp|Q4ZMP0|RS7_PSEU2 30S ribosomal protein S7 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsG PE=3 SV=1 464 598 7.0E-08
sp|Q889X5|RS7_PSESM 30S ribosomal protein S7 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsG PE=3 SV=1 464 598 7.0E-08
sp|A0T0K5|RR7_PHATC 30S ribosomal protein S7, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps7 PE=3 SV=1 470 598 7.0E-08
sp|A6X0B4|RS7_OCHA4 30S ribosomal protein S7 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsG PE=3 SV=1 448 598 7.0E-08
sp|A9IW33|RS7_BART1 30S ribosomal protein S7 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsG PE=3 SV=1 448 598 8.0E-08
sp|Q211E4|RS7_RHOPB 30S ribosomal protein S7 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsG PE=3 SV=1 448 598 8.0E-08
sp|Q39Y10|RS7_GEOMG 30S ribosomal protein S7 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsG PE=3 SV=1 464 598 8.0E-08
sp|C0QQL9|RS7_PERMH 30S ribosomal protein S7 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsG PE=3 SV=1 464 598 8.0E-08
sp|B1WQY6|RS7_CYAA5 30S ribosomal protein S7 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsG PE=3 SV=1 463 598 9.0E-08
sp|B7K836|RS7_CYAP7 30S ribosomal protein S7 OS=Cyanothece sp. (strain PCC 7424) GN=rpsG PE=3 SV=1 463 598 9.0E-08
sp|Q839H0|RS7_ENTFA 30S ribosomal protein S7 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsG PE=3 SV=1 449 598 9.0E-08
sp|B8FET8|RS7_DESAA 30S ribosomal protein S7 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpsG PE=3 SV=1 457 598 9.0E-08
sp|A5EX67|RS7_DICNV 30S ribosomal protein S7 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsG PE=3 SV=1 451 598 9.0E-08
sp|A5USJ3|RS7_ROSS1 30S ribosomal protein S7 OS=Roseiflexus sp. (strain RS-1) GN=rpsG PE=3 SV=1 460 598 9.0E-08
sp|C0QVZ2|RS7_BRAHW 30S ribosomal protein S7 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rpsG PE=3 SV=1 453 598 9.0E-08
sp|A7Y3J9|RR7_IPOPU 30S ribosomal protein S7, chloroplastic OS=Ipomoea purpurea GN=rps7-A PE=3 SV=1 451 598 1.0E-07
sp|B7J1V8|RS7_BORBZ 30S ribosomal protein S7 OS=Borrelia burgdorferi (strain ZS7) GN=rpsG PE=3 SV=1 474 598 1.0E-07
sp|O51347|RS7_BORBU 30S ribosomal protein S7 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsG PE=3 SV=1 474 598 1.0E-07
sp|P62733|RR7_WHEAT 30S ribosomal protein S7, chloroplastic OS=Triticum aestivum GN=rps7-A PE=3 SV=1 451 597 1.0E-07
sp|P0C491|RR7_ORYSJ 30S ribosomal protein S7, chloroplastic OS=Oryza sativa subsp. japonica GN=rps7-A PE=3 SV=1 451 597 1.0E-07
sp|P0C490|RR7_ORYSI 30S ribosomal protein S7, chloroplastic OS=Oryza sativa subsp. indica GN=rps7-A PE=3 SV=1 451 597 1.0E-07
sp|P0C489|RR7_ORYSA 30S ribosomal protein S7, chloroplastic OS=Oryza sativa GN=rps7-A PE=3 SV=1 451 597 1.0E-07
sp|Q6ENC1|RR7_ORYNI 30S ribosomal protein S7, chloroplastic OS=Oryza nivara GN=rps7-A PE=3 SV=1 451 597 1.0E-07
sp|B6JES9|RS7_OLICO 30S ribosomal protein S7 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsG PE=3 SV=1 448 598 1.0E-07
sp|C0ZIH4|RS7_BREBN 30S ribosomal protein S7 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsG PE=3 SV=1 449 598 1.0E-07
sp|Q5FTY0|RS7_GLUOX 30S ribosomal protein S7 OS=Gluconobacter oxydans (strain 621H) GN=rpsG PE=3 SV=1 448 598 1.0E-07
sp|Q87L44|RS7_VIBPA 30S ribosomal protein S7 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsG PE=3 SV=1 464 598 1.0E-07
sp|P02360|RR7_EUGGR 30S ribosomal protein S7, chloroplastic OS=Euglena gracilis GN=rps7 PE=3 SV=2 466 598 1.0E-07
sp|Q8W8V0|RR7_PSINU 30S ribosomal protein S7, chloroplastic OS=Psilotum nudum GN=rps7-A PE=3 SV=1 450 598 2.0E-07
sp|A6H5M8|RR7_CYCTA 30S ribosomal protein S7, chloroplastic OS=Cycas taitungensis GN=rps7-A PE=3 SV=1 452 598 2.0E-07
sp|Q71L33|RR7_CYCRE 30S ribosomal protein S7, chloroplastic OS=Cycas revoluta GN=rps7 PE=3 SV=1 452 598 2.0E-07
sp|Q97SQ4|RS7_STRPN 30S ribosomal protein S7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|A7MZ63|RS7_VIBCB 30S ribosomal protein S7 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|C1CPE4|RS7_STRZT 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|C1CIF2|RS7_STRZP 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain P1031) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|C1CC61|RS7_STRZJ 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain JJA) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|Q8CWU6|RS7_STRR6 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|B2ISJ8|RS7_STRPS 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|B8ZKT9|RS7_STRPJ 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|B1I8Z8|RS7_STRPI 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|C1CB45|RS7_STRP7 30S ribosomal protein S7 OS=Streptococcus pneumoniae (strain 70585) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|B5E6U4|RS7_STRP4 30S ribosomal protein S7 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|Q04MH8|RS7_STRP2 30S ribosomal protein S7 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|P49495|RR7_ODOSI 30S ribosomal protein S7, chloroplastic OS=Odontella sinensis GN=rps7 PE=3 SV=1 453 594 2.0E-07
sp|C3LR92|RS7_VIBCM 30S ribosomal protein S7 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|Q9KUZ8|RS7_VIBCH 30S ribosomal protein S7 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|A5F3J8|RS7_VIBC3 30S ribosomal protein S7 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|A5GW12|RS7_SYNR3 30S ribosomal protein S7 OS=Synechococcus sp. (strain RCC307) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|Q661N2|RS7_BORBP 30S ribosomal protein S7 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsG PE=3 SV=1 474 598 2.0E-07
sp|Q9MSQ3|RR7_ZAMFU 30S ribosomal protein S7, chloroplastic OS=Zamia furfuracea GN=rps7 PE=3 SV=1 452 598 2.0E-07
sp|C5BQ42|RS7_TERTT 30S ribosomal protein S7 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsG PE=3 SV=1 474 598 2.0E-07
sp|Q1R0H9|RS7_CHRSD 30S ribosomal protein S7 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsG PE=3 SV=1 474 598 2.0E-07
sp|Q7U4D3|RS7_SYNPX 30S ribosomal protein S7 OS=Synechococcus sp. (strain WH8102) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|A1KB31|RS7_AZOSB 30S ribosomal protein S7 OS=Azoarcus sp. (strain BH72) GN=rpsG PE=3 SV=1 474 598 2.0E-07
sp|B7VLG1|RS7_VIBTL 30S ribosomal protein S7 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|Q06R71|RR7_JASNU 30S ribosomal protein S7, chloroplastic OS=Jasminum nudiflorum GN=rps7-A PE=3 SV=1 451 597 2.0E-07
sp|B2J5A9|RS7_NOSP7 30S ribosomal protein S7 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsG PE=3 SV=1 470 598 2.0E-07
sp|P0CE06|RS7_CHLTR 30S ribosomal protein S7 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsG PE=3 SV=1 470 598 2.0E-07
sp|Q3KLR2|RS7_CHLTA 30S ribosomal protein S7 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsG PE=3 SV=1 470 598 2.0E-07
sp|Q0AUH6|RS7_SYNWW 30S ribosomal protein S7 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsG PE=3 SV=1 452 598 2.0E-07
sp|A0LRL6|RS7_ACIC1 30S ribosomal protein S7 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|Q6G2W1|RS7_BARHE 30S ribosomal protein S7 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsG PE=3 SV=1 448 598 2.0E-07
sp|Q31IY6|RS7_THICR 30S ribosomal protein S7 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|Q7VJ84|RS7_HELHP 30S ribosomal protein S7 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsG PE=3 SV=1 464 598 2.0E-07
sp|Q8DXS6|RS7_STRA5 30S ribosomal protein S7 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|Q8E3E6|RS7_STRA3 30S ribosomal protein S7 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|Q3JZB4|RS7_STRA1 30S ribosomal protein S7 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsG PE=3 SV=1 451 598 2.0E-07
sp|Q03PV3|RS7_LACBA 30S ribosomal protein S7 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|B1Y7G8|RS7_LEPCP 30S ribosomal protein S7 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsG PE=3 SV=1 471 598 3.0E-07
sp|B4U740|RS7_HYDS0 30S ribosomal protein S7 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsG PE=3 SV=1 452 597 3.0E-07
sp|A7NR67|RS7_ROSCS 30S ribosomal protein S7 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpsG PE=3 SV=1 460 598 3.0E-07
sp|Q9Z9L8|RS7_BACHD 30S ribosomal protein S7 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsG PE=3 SV=1 449 598 3.0E-07
sp|B0BC75|RS7_CHLTB 30S ribosomal protein S7 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsG PE=3 SV=1 470 598 3.0E-07
sp|B0B810|RS7_CHLT2 30S ribosomal protein S7 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsG PE=3 SV=1 470 598 3.0E-07
sp|Q605A8|RS7_METCA 30S ribosomal protein S7 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsG PE=3 SV=1 471 598 3.0E-07
sp|Q74L91|RS7_LACJO 30S ribosomal protein S7 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|A6T3K8|RS7_JANMA 30S ribosomal protein S7 OS=Janthinobacterium sp. (strain Marseille) GN=rpsG PE=3 SV=1 474 598 3.0E-07
sp|Q0SNC1|RS7_BORAP 30S ribosomal protein S7 OS=Borrelia afzelii (strain PKo) GN=rpsG PE=3 SV=1 474 598 3.0E-07
sp|A2SLG1|RS7_METPP 30S ribosomal protein S7 OS=Methylibium petroleiphilum (strain PM1) GN=rpsG PE=3 SV=1 471 598 3.0E-07
sp|A0LII7|RS7_SYNFM 30S ribosomal protein S7 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|Q046C8|RS7_LACGA 30S ribosomal protein S7 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|Q2IXR4|RS7_RHOP2 30S ribosomal protein S7 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsG PE=3 SV=1 474 598 3.0E-07
sp|A9H3R8|RS7_GLUDA 30S ribosomal protein S7 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsG PE=3 SV=1 448 598 3.0E-07
sp|Q7VA03|RS7_PROMA 30S ribosomal protein S7 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|Q6FZB8|RS7_BARQU 30S ribosomal protein S7 OS=Bartonella quintana (strain Toulouse) GN=rpsG PE=3 SV=1 448 598 3.0E-07
sp|Q0SFF2|RS7_RHOJR 30S ribosomal protein S7 OS=Rhodococcus jostii (strain RHA1) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|B2A4D5|RS7_NATTJ 30S ribosomal protein S7 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsG PE=3 SV=1 451 598 3.0E-07
sp|B5FG05|RS7_VIBFM 30S ribosomal protein S7 OS=Vibrio fischeri (strain MJ11) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|Q5E8C0|RS7_VIBF1 30S ribosomal protein S7 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|Q6YQW0|RS7_ONYPE 30S ribosomal protein S7 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsG PE=3 SV=1 478 598 3.0E-07
sp|A9BCK2|RS7_PROM4 30S ribosomal protein S7 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsG PE=3 SV=1 464 598 3.0E-07
sp|Q9PJV5|RS7_CHLMU 30S ribosomal protein S7 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsG PE=3 SV=1 470 598 3.0E-07
sp|A4G9U2|RS7_HERAR 30S ribosomal protein S7 OS=Herminiimonas arsenicoxydans GN=rpsG PE=3 SV=1 474 598 4.0E-07
sp|B3QBY4|RS7_RHOPT 30S ribosomal protein S7 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsG PE=3 SV=1 474 598 4.0E-07
sp|Q6N4T3|RS7_RHOPA 30S ribosomal protein S7 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsG PE=1 SV=3 474 598 4.0E-07
sp|A7HWQ7|RS7_PARL1 30S ribosomal protein S7 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsG PE=3 SV=1 451 598 4.0E-07
sp|P13577|RS7_ARTPT 30S ribosomal protein S7 OS=Arthrospira platensis GN=rpsG PE=3 SV=1 457 598 4.0E-07
sp|A1WVC6|RS7_HALHL 30S ribosomal protein S7 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsG PE=3 SV=1 464 598 4.0E-07
sp|B2V7L7|RS7_SULSY 30S ribosomal protein S7 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsG PE=3 SV=1 464 598 4.0E-07
sp|P18661|RS7_SYNP6 30S ribosomal protein S7 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsG PE=3 SV=2 464 598 4.0E-07
sp|Q31PV3|RS7_SYNE7 30S ribosomal protein S7 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsG PE=3 SV=1 464 598 4.0E-07
sp|A1USL0|RS7_BARBK 30S ribosomal protein S7 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsG1 PE=3 SV=1 448 598 4.0E-07
sp|A8AUR5|RS7_STRGC 30S ribosomal protein S7 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsG PE=3 SV=1 451 598 4.0E-07
sp|Q3AW55|RS7_SYNS9 30S ribosomal protein S7 OS=Synechococcus sp. (strain CC9902) GN=rpsG PE=3 SV=1 464 598 5.0E-07
sp|B2IK58|RS7_BEII9 30S ribosomal protein S7 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsG PE=3 SV=1 462 598 5.0E-07
sp|B2UUV7|RS7_HELPS 30S ribosomal protein S7 OS=Helicobacter pylori (strain Shi470) GN=rpsG PE=3 SV=1 474 598 5.0E-07
sp|Q2YB01|RS7_NITMU 30S ribosomal protein S7 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsG PE=3 SV=1 474 598 5.0E-07
sp|A6W5T3|RS7_KINRD 30S ribosomal protein S7 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpsG PE=3 SV=1 452 598 5.0E-07
sp|Q6KGW7|RR7_SAGLA 30S ribosomal protein S7, chloroplastic OS=Sagittaria latifolia GN=rps7 PE=3 SV=1 464 597 5.0E-07
sp|C0ZVT5|RS7_RHOE4 30S ribosomal protein S7 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsG PE=3 SV=1 464 598 5.0E-07
sp|Q19V71|RR7_CHLAT 30S ribosomal protein S7, chloroplastic OS=Chlorokybus atmophyticus GN=rps7 PE=3 SV=2 464 598 6.0E-07
sp|Q9GFL3|RR7_GINBI 30S ribosomal protein S7, chloroplastic OS=Ginkgo biloba GN=rps7 PE=3 SV=1 452 593 6.0E-07
sp|B5Y991|RS7_COPPD 30S ribosomal protein S7 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsG PE=3 SV=1 456 598 6.0E-07
sp|C1DAR3|RS7_LARHH 30S ribosomal protein S7 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsG PE=3 SV=1 452 598 6.0E-07
sp|A1TYJ3|RS7_MARHV 30S ribosomal protein S7 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsG PE=3 SV=1 474 598 6.0E-07
sp|Q5L401|RS7_GEOKA 30S ribosomal protein S7 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsG PE=3 SV=1 449 598 6.0E-07
sp|Q3ZZM7|RS7_DEHMC 30S ribosomal protein S7 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsG PE=3 SV=1 452 598 7.0E-07
sp|A5FRY6|RS7_DEHMB 30S ribosomal protein S7 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsG PE=3 SV=1 452 598 7.0E-07
sp|P66609|RS7_HELPY 30S ribosomal protein S7 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsG PE=3 SV=1 474 598 7.0E-07
sp|P66610|RS7_HELPJ 30S ribosomal protein S7 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsG PE=3 SV=1 474 598 7.0E-07
sp|Q1CS70|RS7_HELPH 30S ribosomal protein S7 OS=Helicobacter pylori (strain HPAG1) GN=rpsG PE=3 SV=1 474 598 7.0E-07
sp|B6JN35|RS7_HELP2 30S ribosomal protein S7 OS=Helicobacter pylori (strain P12) GN=rpsG PE=3 SV=1 474 598 7.0E-07
sp|Q17VN8|RS7_HELAH 30S ribosomal protein S7 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsG PE=3 SV=1 474 598 7.0E-07
sp|Q3Z984|RS7_DEHM1 30S ribosomal protein S7 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsG PE=3 SV=1 452 598 7.0E-07
sp|Q7MH41|RS7_VIBVY 30S ribosomal protein S7 OS=Vibrio vulnificus (strain YJ016) GN=rpsG PE=3 SV=1 464 598 7.0E-07
sp|Q8DCQ9|RS7_VIBVU 30S ribosomal protein S7 OS=Vibrio vulnificus (strain CMCP6) GN=rpsG PE=3 SV=1 464 598 7.0E-07
sp|Q3K5Y4|RS7_PSEPF 30S ribosomal protein S7 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsG PE=3 SV=1 464 598 8.0E-07
sp|A0KRM0|RS7_SHESA 30S ribosomal protein S7 OS=Shewanella sp. (strain ANA-3) GN=rpsG PE=3 SV=1 464 598 8.0E-07
sp|A4IJI5|RS7_GEOTN 30S ribosomal protein S7 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsG PE=3 SV=1 449 598 8.0E-07
sp|A6MW27|RR7_RHDSA 30S ribosomal protein S7, chloroplastic OS=Rhodomonas salina GN=rps7 PE=3 SV=1 464 598 8.0E-07
sp|Q6LVC2|RS7_PHOPR 30S ribosomal protein S7 OS=Photobacterium profundum GN=rpsG PE=3 SV=1 464 598 8.0E-07
sp|Q0ANP6|RS7_MARMM 30S ribosomal protein S7 OS=Maricaulis maris (strain MCS10) GN=rpsG PE=3 SV=1 464 598 8.0E-07
sp|A4J107|RS7_DESRM 30S ribosomal protein S7 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsG PE=3 SV=1 474 598 9.0E-07
sp|Q3AMT4|RS7_SYNSC 30S ribosomal protein S7 OS=Synechococcus sp. (strain CC9605) GN=rpsG PE=3 SV=1 464 598 9.0E-07
sp|O50564|RS7_THIDL 30S ribosomal protein S7 OS=Thiomonas delicata GN=rpsG PE=3 SV=1 474 593 9.0E-07
sp|P66620|RS7_STRP8 30S ribosomal protein S7 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsG PE=3 SV=1 451 598 9.0E-07
sp|P66619|RS7_STRP1 30S ribosomal protein S7 OS=Streptococcus pyogenes serotype M1 GN=rpsG PE=3 SV=1 451 598 9.0E-07
sp|C1AYS5|RS7_RHOOB 30S ribosomal protein S7 OS=Rhodococcus opacus (strain B4) GN=rpsG PE=3 SV=1 464 598 9.0E-07
sp|A4SUV7|RS7_POLSQ 30S ribosomal protein S7 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsG PE=3 SV=1 474 598 9.0E-07
sp|B5EFP6|RS7_GEOBB 30S ribosomal protein S7 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsG PE=3 SV=1 464 598 9.0E-07
sp|Q1MIE5|RS7_RHIL3 30S ribosomal protein S7 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsG PE=3 SV=1 448 598 1.0E-06
sp|Q67JT9|RS7_SYMTH 30S ribosomal protein S7 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsG PE=3 SV=1 464 597 1.0E-06
sp|C6E4R1|RS7_GEOSM 30S ribosomal protein S7 OS=Geobacter sp. (strain M21) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q9Z801|RS7_CHLPN 30S ribosomal protein S7 OS=Chlamydia pneumoniae GN=rpsG PE=3 SV=1 470 598 1.0E-06
sp|B9M6U9|RS7_GEODF 30S ribosomal protein S7 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q3SSX0|RS7_NITWN 30S ribosomal protein S7 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsG PE=3 SV=1 448 598 1.0E-06
sp|Q2LQA4|RS7_SYNAS 30S ribosomal protein S7 OS=Syntrophus aciditrophicus (strain SB) GN=rpsG PE=3 SV=2 464 598 1.0E-06
sp|B7GJ63|RS7_ANOFW 30S ribosomal protein S7 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsG PE=3 SV=1 452 598 1.0E-06
sp|B4R8L2|RS7_PHEZH 30S ribosomal protein S7 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|A5GIP2|RS7_SYNPW 30S ribosomal protein S7 OS=Synechococcus sp. (strain WH7803) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q0I0A9|RS7_SHESR 30S ribosomal protein S7 OS=Shewanella sp. (strain MR-7) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q0HNU1|RS7_SHESM 30S ribosomal protein S7 OS=Shewanella sp. (strain MR-4) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q8EK72|RS7_SHEON 30S ribosomal protein S7 OS=Shewanella oneidensis (strain MR-1) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|A9NEN2|RS7_ACHLI 30S ribosomal protein S7 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|B0Z5H3|RR7_OENPA 30S ribosomal protein S7, chloroplastic OS=Oenothera parviflora GN=rps7-A PE=3 SV=1 451 598 1.0E-06
sp|B0Z589|RR7_OENGL 30S ribosomal protein S7, chloroplastic OS=Oenothera glazioviana GN=rps7-A PE=3 SV=1 451 598 1.0E-06
sp|Q9ME90|RR7_OENEH 30S ribosomal protein S7, chloroplastic OS=Oenothera elata subsp. hookeri GN=rps7-A PE=3 SV=2 451 598 1.0E-06
sp|B0Z505|RR7_OENBI 30S ribosomal protein S7, chloroplastic OS=Oenothera biennis GN=rps7-A PE=3 SV=1 451 598 1.0E-06
sp|B0Z4S1|RR7_OENAR 30S ribosomal protein S7, chloroplastic OS=Oenothera argillicola GN=rps7-A PE=3 SV=1 451 598 1.0E-06
sp|Q7V502|RS7_PROMM 30S ribosomal protein S7 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|A2CC85|RS7_PROM3 30S ribosomal protein S7 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q0BYB0|RS7_HYPNA 30S ribosomal protein S7 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsG PE=3 SV=1 448 598 1.0E-06
sp|B1XSP7|RS7_POLNS 30S ribosomal protein S7 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpsG PE=3 SV=1 474 598 1.0E-06
sp|B6EPR6|RS7_ALISL 30S ribosomal protein S7 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|B1I1I4|RS7_DESAP 30S ribosomal protein S7 OS=Desulforudis audaxviator (strain MP104C) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|B1X4W8|RR7_PAUCH 30S ribosomal protein S7, organellar chromatophore OS=Paulinella chromatophora GN=rps7 PE=3 SV=1 464 598 1.0E-06
sp|A8W3M5|RR7_CUSOB 30S ribosomal protein S7, plastid OS=Cuscuta obtusiflora GN=rps7-A PE=3 SV=1 464 598 1.0E-06
sp|A7M939|RR7_CUSGR 30S ribosomal protein S7, plastid OS=Cuscuta gronovii GN=rps7-A PE=3 SV=1 464 598 1.0E-06
sp|P46292|RR7_CUSEU 30S ribosomal protein S7, plastid OS=Cuscuta europaea GN=rps7 PE=3 SV=1 464 598 1.0E-06
sp|Q2S3R8|RS7_SALRD 30S ribosomal protein S7 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsG PE=3 SV=1 449 598 1.0E-06
sp|Q0ID57|RS7_SYNS3 30S ribosomal protein S7 OS=Synechococcus sp. (strain CC9311) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q8R7V0|RS7_CALS4 30S ribosomal protein S7 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsG PE=3 SV=1 476 598 1.0E-06
sp|A5GAY4|RS7_GEOUR 30S ribosomal protein S7 OS=Geobacter uraniireducens (strain Rf4) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q04ED5|RS7_OENOB 30S ribosomal protein S7 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsG PE=3 SV=1 464 598 1.0E-06
sp|Q3J8R0|RS7_NITOC 30S ribosomal protein S7 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsG PE=3 SV=1 474 598 1.0E-06
sp|Q82T69|RS7_NITEU 30S ribosomal protein S7 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|B0YPL5|RR7_ANEMR 30S ribosomal protein S7, plastid OS=Aneura mirabilis GN=rps7 PE=3 SV=1 453 598 2.0E-06
sp|Q2NJ18|RS7_AYWBP 30S ribosomal protein S7 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsG PE=3 SV=1 478 598 2.0E-06
sp|Q5P336|RS7_AROAE 30S ribosomal protein S7 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsG PE=3 SV=1 474 598 2.0E-06
sp|B0SSI1|RS7_LEPBP 30S ribosomal protein S7 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|B0SAF8|RS7_LEPBA 30S ribosomal protein S7 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|P51288|RR7_PORPU 30S ribosomal protein S7, chloroplastic OS=Porphyra purpurea GN=rps7 PE=3 SV=1 464 598 2.0E-06
sp|P22744|RS7_GEOSE 30S ribosomal protein S7 OS=Geobacillus stearothermophilus GN=rpsG PE=1 SV=3 449 598 2.0E-06
sp|Q748Y7|RS7_GEOSL 30S ribosomal protein S7 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|Q5WLR6|RS7_BACSK 30S ribosomal protein S7 OS=Bacillus clausii (strain KSM-K16) GN=rpsG PE=3 SV=1 449 598 2.0E-06
sp|B0K5H2|RS7_THEPX 30S ribosomal protein S7 OS=Thermoanaerobacter sp. (strain X514) GN=rpsG PE=3 SV=1 476 598 2.0E-06
sp|B5RRJ4|RS7_BORRA 30S ribosomal protein S7 OS=Borrelia recurrentis (strain A1) GN=rpsG PE=3 SV=1 474 598 2.0E-06
sp|B5RLU6|RS7_BORDL 30S ribosomal protein S7 OS=Borrelia duttonii (strain Ly) GN=rpsG PE=3 SV=1 474 598 2.0E-06
sp|A5D5I6|RS7_PELTS 30S ribosomal protein S7 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|Q4JT38|RS7_CORJK 30S ribosomal protein S7 OS=Corynebacterium jeikeium (strain K411) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|O66944|RS7B_AQUAE 30S ribosomal protein S7-2 OS=Aquifex aeolicus (strain VF5) GN=rpsG2 PE=3 SV=1 464 596 2.0E-06
sp|Q118Z4|RS7_TRIEI 30S ribosomal protein S7 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsG PE=3 SV=1 463 598 2.0E-06
sp|B7JUP7|RS7_CYAP8 30S ribosomal protein S7 OS=Cyanothece sp. (strain PCC 8801) GN=rpsG PE=3 SV=1 463 597 2.0E-06
sp|Q46IW2|RS7_PROMT 30S ribosomal protein S7 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|A2C4U7|RS7_PROM1 30S ribosomal protein S7 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|B0CCD2|RS7_ACAM1 30S ribosomal protein S7 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsG PE=3 SV=1 463 598 2.0E-06
sp|B4S5N1|RS7_PROA2 30S ribosomal protein S7 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsG PE=3 SV=1 478 598 2.0E-06
sp|Q47LI9|RS7_THEFY 30S ribosomal protein S7 OS=Thermobifida fusca (strain YX) GN=rpsG PE=3 SV=1 462 598 2.0E-06
sp|Q2N9A6|RS7_ERYLH 30S ribosomal protein S7 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsG PE=3 SV=1 453 598 2.0E-06
sp|Q8D3H3|RS7_WIGBR 30S ribosomal protein S7 OS=Wigglesworthia glossinidia brevipalpis GN=rpsG PE=3 SV=1 464 598 2.0E-06
sp|B4SBU3|RS7_PELPB 30S ribosomal protein S7 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsG PE=3 SV=1 474 598 2.0E-06
sp|B6IRQ2|RS7_RHOCS 30S ribosomal protein S7 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsG PE=3 SV=1 455 598 2.0E-06
sp|A3DIZ8|RS7_CLOTH 30S ribosomal protein S7 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsG PE=3 SV=1 452 598 2.0E-06
sp|A4VSN2|RS7_STRSY 30S ribosomal protein S7 OS=Streptococcus suis (strain 05ZYH33) GN=rpsG PE=3 SV=1 451 598 2.0E-06
sp|A4VYX5|RS7_STRS2 30S ribosomal protein S7 OS=Streptococcus suis (strain 98HAH33) GN=rpsG PE=3 SV=1 451 598 2.0E-06
sp|Q3A9R1|RS7_CARHZ 30S ribosomal protein S7 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsG PE=3 SV=1 476 598 2.0E-06
sp|Q47UW2|RS7_COLP3 30S ribosomal protein S7 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsG PE=3 SV=1 464 598 3.0E-06
sp|B8ZSC3|RS7_MYCLB 30S ribosomal protein S7 OS=Mycobacterium leprae (strain Br4923) GN=rpsG PE=3 SV=1 464 598 3.0E-06
sp|B3E7T1|RS7_GEOLS 30S ribosomal protein S7 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsG PE=3 SV=1 464 598 3.0E-06
sp|C4Z2R7|RS7_EUBE2 30S ribosomal protein S7 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=rpsG PE=3 SV=1 476 598 3.0E-06
sp|C5CP59|RS7_VARPS 30S ribosomal protein S7 OS=Variovorax paradoxus (strain S110) GN=rpsG PE=3 SV=1 471 598 3.0E-06
sp|Q8DVV5|RS7_STRMU 30S ribosomal protein S7 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsG PE=3 SV=1 451 598 3.0E-06
sp|A0ALZ0|RS7_LISW6 30S ribosomal protein S7 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsG PE=3 SV=1 449 598 3.0E-06
sp|P66611|RS7_LISMO 30S ribosomal protein S7 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsG PE=3 SV=1 449 598 3.0E-06
sp|B8DAY5|RS7_LISMH 30S ribosomal protein S7 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsG PE=3 SV=1 449 598 3.0E-06
sp|Q71WB7|RS7_LISMF 30S ribosomal protein S7 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsG PE=3 SV=1 449 598 3.0E-06
sp|C1KZK8|RS7_LISMC 30S ribosomal protein S7 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsG PE=3 SV=1 449 598 3.0E-06
sp|P66612|RS7_LISIN 30S ribosomal protein S7 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsG PE=3 SV=1 449 598 3.0E-06
sp|Q2RFP3|RS7_MOOTA 30S ribosomal protein S7 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsG PE=3 SV=1 476 598 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|031540
MITVSVVLFVLFISSGFADTLRGRAENDIISPKSFAVLPDDFTYRTDSFAQHFKPANSTQAPTFQIFNEAFLDII
GSSPSISEIASNSSYAFAHEGPIYISETEEVFFASNAGGALGMSDFNHNNAFFKLSLSEAEEMLGSGGNNKTVNV
PITQIPLSDSIQMTSGGTGPFNGNLILSNSGRGPLPPTLALVNSKPPYNSTILLNNFYGRQYNSLNDVKVHPTSG
NLFFSDTTYGSIQQFRDKPTLPSQVYRFDMNTGAVQVVANNFDQANGIAFTGDGKTVYIGDSGAAGGTPTQPSTI
YAFDVDEKTQALSSRRVLAYIDAGAPDGIQVDEKGNVYVACADGVQVFAPDGTLLGKFFLDISSANMVFAGPGRM
VILAETKVFLAKISENTKGVSVTSMLLPSLRSTTIRSSKPLVRTYASAPKNEDIMRDVLGTFGSQSDSEQAIHPE
TRQTRTPDNDYTIPPAQDPLLEFFASRMMEGGKRARAEKATSEILLHIHALTKAPPLPVLRQAVQMAAPAVRVMS
HKMGGKALVKPIALNERQRTRRAIGWILEESNSRPGHTRGERVARECIGILQKSSKVLELKDRAHQVALINRGNL
PRMRA*
Coding >Agabi119p4|031540
ATGATCACCGTCTCGGTCGTGCTATTCGTGCTATTTATCTCCTCTGGATTTGCAGACACACTTAGAGGCCGAGCT
GAAAATGACATCATAAGCCCCAAATCGTTCGCCGTCCTCCCAGACGACTTTACCTACCGCACTGACAGTTTCGCT
CAACATTTCAAGCCAGCCAATTCCACACAAGCCCCTACATTCCAAATTTTCAATGAAGCTTTCCTCGATATCATA
GGCTCATCACCTTCCATATCCGAAATTGCATCTAATTCGTCTTATGCTTTCGCGCATGAAGGACCTATATATATT
TCCGAAACGGAAGAAGTATTTTTTGCGAGTAATGCTGGAGGAGCGTTGGGTATGAGTGATTTCAATCATAACAAT
GCGTTTTTCAAGTTGAGTTTGAGTGAGGCGGAGGAAATGTTGGGGTCTGGAGGGAATAACAAGACTGTGAATGTG
CCTATTACTCAGATTCCATTGTCGGACAGTATACAAATGACAAGTGGTGGTACGGGTCCATTCAACGGTAATCTC
ATACTTTCCAACTCGGGTCGCGGACCATTACCACCCACACTTGCGTTGGTCAACTCAAAACCACCTTACAATTCC
ACGATACTCTTGAATAATTTCTATGGCCGACAGTATAATTCTCTGAACGATGTCAAAGTTCATCCGACGAGTGGA
AATCTATTTTTTTCGGATACCACGTATGGATCTATTCAACAGTTTCGTGATAAGCCTACACTTCCGAGTCAAGTG
TATCGCTTTGATATGAATACCGGTGCTGTTCAAGTTGTAGCCAACAATTTCGATCAAGCAAACGGAATTGCATTT
ACAGGAGATGGTAAAACTGTATACATTGGCGATTCTGGTGCTGCAGGTGGAACTCCAACTCAACCGAGTACAATC
TACGCGTTCGATGTTGATGAAAAGACACAAGCACTTTCGAGTCGTCGAGTACTGGCCTACATCGACGCTGGTGCT
CCCGATGGAATACAAGTTGACGAGAAGGGAAACGTGTATGTCGCTTGCGCTGATGGCGTTCAAGTCTTTGCTCCT
GATGGCACGTTACTTGGGAAATTCTTTTTGGACATCTCGAGTGCCAATATGGTTTTTGCGGGTCCTGGCAGAATG
GTTATTTTAGCGGAGACAAAGGTGTTTTTGGCAAAGATTTCGGAAAACACCAAGGGTGTGTCTGTCACCTCGATG
CTGCTTCCGTCGTTGCGCTCGACGACGATTCGCTCGTCAAAACCGCTCGTACGCACATACGCTTCTGCACCAAAG
AATGAAGACATCATGCGCGATGTACTCGGCACATTCGGGTCTCAATCCGACTCTGAACAAGCAATTCATCCAGAG
ACGCGCCAAACTCGTACACCCGACAATGACTACACCATACCACCGGCTCAAGACCCCTTACTTGAATTCTTCGCT
TCCCGTATGATGGAAGGTGGCAAACGCGCTCGTGCCGAAAAAGCGACTTCAGAAATTCTATTACACATTCATGCA
TTGACCAAAGCGCCTCCTTTACCCGTGTTACGACAGGCTGTGCAAATGGCTGCACCTGCTGTGAGGGTGATGTCG
CACAAGATGGGTGGAAAGGCGTTGGTGAAGCCTATTGCGTTGAATGAGAGACAGAGGACGAGGAGGGCTATTGGA
TGGATTTTGGAAGAGAGTAATTCGCGGCCGGGGCATACAAGGGGAGAACGGGTTGCGCGAGAGTGTATTGGCATT
TTGCAAAAGTCGAGCAAGGTTCTCGAGTTGAAGGACAGAGCACACCAAGTCGCTTTGATCAACAGAGGAAATCTT
CCGCGGATGAGGGCCTAG
Transcript >Agabi119p4|031540
ATGATCACCGTCTCGGTCGTGCTATTCGTGCTATTTATCTCCTCTGGATTTGCAGACACACTTAGAGGCCGAGCT
GAAAATGACATCATAAGCCCCAAATCGTTCGCCGTCCTCCCAGACGACTTTACCTACCGCACTGACAGTTTCGCT
CAACATTTCAAGCCAGCCAATTCCACACAAGCCCCTACATTCCAAATTTTCAATGAAGCTTTCCTCGATATCATA
GGCTCATCACCTTCCATATCCGAAATTGCATCTAATTCGTCTTATGCTTTCGCGCATGAAGGACCTATATATATT
TCCGAAACGGAAGAAGTATTTTTTGCGAGTAATGCTGGAGGAGCGTTGGGTATGAGTGATTTCAATCATAACAAT
GCGTTTTTCAAGTTGAGTTTGAGTGAGGCGGAGGAAATGTTGGGGTCTGGAGGGAATAACAAGACTGTGAATGTG
CCTATTACTCAGATTCCATTGTCGGACAGTATACAAATGACAAGTGGTGGTACGGGTCCATTCAACGGTAATCTC
ATACTTTCCAACTCGGGTCGCGGACCATTACCACCCACACTTGCGTTGGTCAACTCAAAACCACCTTACAATTCC
ACGATACTCTTGAATAATTTCTATGGCCGACAGTATAATTCTCTGAACGATGTCAAAGTTCATCCGACGAGTGGA
AATCTATTTTTTTCGGATACCACGTATGGATCTATTCAACAGTTTCGTGATAAGCCTACACTTCCGAGTCAAGTG
TATCGCTTTGATATGAATACCGGTGCTGTTCAAGTTGTAGCCAACAATTTCGATCAAGCAAACGGAATTGCATTT
ACAGGAGATGGTAAAACTGTATACATTGGCGATTCTGGTGCTGCAGGTGGAACTCCAACTCAACCGAGTACAATC
TACGCGTTCGATGTTGATGAAAAGACACAAGCACTTTCGAGTCGTCGAGTACTGGCCTACATCGACGCTGGTGCT
CCCGATGGAATACAAGTTGACGAGAAGGGAAACGTGTATGTCGCTTGCGCTGATGGCGTTCAAGTCTTTGCTCCT
GATGGCACGTTACTTGGGAAATTCTTTTTGGACATCTCGAGTGCCAATATGGTTTTTGCGGGTCCTGGCAGAATG
GTTATTTTAGCGGAGACAAAGGTGTTTTTGGCAAAGATTTCGGAAAACACCAAGGGTGTGTCTGTCACCTCGATG
CTGCTTCCGTCGTTGCGCTCGACGACGATTCGCTCGTCAAAACCGCTCGTACGCACATACGCTTCTGCACCAAAG
AATGAAGACATCATGCGCGATGTACTCGGCACATTCGGGTCTCAATCCGACTCTGAACAAGCAATTCATCCAGAG
ACGCGCCAAACTCGTACACCCGACAATGACTACACCATACCACCGGCTCAAGACCCCTTACTTGAATTCTTCGCT
TCCCGTATGATGGAAGGTGGCAAACGCGCTCGTGCCGAAAAAGCGACTTCAGAAATTCTATTACACATTCATGCA
TTGACCAAAGCGCCTCCTTTACCCGTGTTACGACAGGCTGTGCAAATGGCTGCACCTGCTGTGAGGGTGATGTCG
CACAAGATGGGTGGAAAGGCGTTGGTGAAGCCTATTGCGTTGAATGAGAGACAGAGGACGAGGAGGGCTATTGGA
TGGATTTTGGAAGAGAGTAATTCGCGGCCGGGGCATACAAGGGGAGAACGGGTTGCGCGAGAGTGTATTGGCATT
TTGCAAAAGTCGAGCAAGGTTCTCGAGTTGAAGGACAGAGCACACCAAGTCGCTTTGATCAACAGAGGAAATCTT
CCGCGGATGAGGGCCTAG
Gene >Agabi119p4|031540
ATGATCACCGTCTCGGTCGTGCTATTCGTGCTATTTATCTCCTCTGGATTTGCAGACACACTTAGAGGCCGAGCT
GAAAATGACGTATGTAATTATCTTTCTTTGAACTACTGCTTACTTCACTGATTTCAACCTTTTGATCAGATCATA
AGCCCCAAATCGTTCGCCGTCCTCCCAGACGACTTTACCTACCGCACTGACAGTTTCGCTCAACATTTCAAGCCA
GCCAATTCCACACAAGCCCCTACATTCCAAATTTTCAATGAAGCTTTCCTCGATATCATAGGCTCATCACCTTCC
ATATCCGAAATTGCATCTAATTCGTCTTATGCTTTCGCGCATGAAGGACCTATATATATTTCCGAAACGGAAGAA
GTATTTTTTGCGAGTAATGCTGGAGGAGCGTTGGGTATGAGTGATTTCAATCATAACAATGCGTTTTTCAAGTTG
AGTTTGAGTGAGGCGGAGGAAATGTTGGGGTCTGGAGGGAATAACAAGACTGTGAATGTGCCTATTACTCAGGTA
AAAAAAATTTCCCCACTGGATGAATTTCGAGGACTGACTTGTTTTATCAGATTCCATTGTCGGACAGTATACAAA
TGACAAGTGGTGGTACGGGTCCATTCAACGGTAATCTCATACTTTCCAACTCGGGTCGCGGACCATTACCACCCA
CACTTGCGTTGGTCAACTCAAAACCACCTTACAATTCCACGATACTCTTGAATAATTTCTATGGCCGACAGTATA
ATTCTCTGAACGATGTCAAAGTTCATCCGACGAGTGGAAATCTATTTTTTTCGGATACCACGTACGTATTATGCA
AGGTCAACATAATTACGGTGGACTTACTACGAGCTTGACATAAACAGGTATGGATCTATTCAACAGTTTCGTGAT
AAGCCTACACTTCCGAGTCAAGTGTATCGCTTTGATATGAATACCGGTGCTGTTCAAGTTGTAGCCAACAATTTC
GATCAAGCAAACGGAATTGCATTTACAGGAGATGGTAAAACTGTATACATGTAAGAAGAGACAGCAAAAATTTAT
CTCTTTTCTACGTTTTTGACAAATACTTGTTACAGTGGCGATTCTGGTGCTGCAGGTGGAACTCCAACTCAACCG
AGTACAATGTGAGTCACTTTCAGTGTCATCGGATACTTTTGAATTAAAGTTTCGACGTATATAGCTACGCGTTCG
ATGTTGATGAAAAGACACAAGCACTTTCGAGTCGTCGAGTACTGGCCTACATCGACGCTGGTGCTCCCGATGGAA
TACAAGTTGACGAGAAGGGAAACGTGTATGTCGCTTGCGCTGATGGCGTTCAAGTGCGTAAAATAGCAACATATC
CTGGGAGTTGAATTCTGATTTCTTTTTTTACTTAGGTCTTTGCTCCTGATGGCACGTTACTTGGGAAATTCTTTT
TGGACATCTCGAGTGCCAATATGGTTTTTGCGGGTCCTGGCAGAATGGTTATTTTAGCGGAGACAAAGGTGTTTT
TGGCAAAGATTTCGGAAAACACCAAGGGTGTGGTGTCTTAACGTATATGACTTATGTAATAAATCGCACACTCTC
TTGAAGTTAGTCTGTCACCTCGATGCTGCTTCCGTCGTTGCGCTCGACGACGATTCGCTCGTCAAAACCGCTCGT
ACGCACATACGCTTCTGCACCAAAGAATGAAGACATCATGCGCGATGTACTCGGCACATTCGGGTCTCAATCCGA
CTCTGAACAAGCAATTCATCCAGAGACGCGCCAAACTCGTACACCCGACAATGACTACACCATACCACCGGCTCA
AGACCCCTTACTTGAATTCTTCGCTTCCCGTATGATGGAAGGTGGCAAACGCGCTCGTGCCGAAAAAGCGACTTC
AGAAATTCTATTACACATTCATGCATTGACCAAAGCGCCTCCTTTACCCGTGTTACGACAGGCTGTGCAAATGGC
TGCACCTGCTGTGAGGGTGATGTCGCACAAGATGGGTGGAAAGGCGTTGGTGAAGCCTATTGCGTTGAATGAGAG
ACAGAGGACGAGGAGGGCTATTGGATGGATTTTGGAAGAGAGTAATTCGCGGCCGGGGCATACAAGGGGAGAACG
GGTTGCGCGAGAGTGTATTGGCATTTTGCAAAAGTCGAGCAAGGTTCTCGAGTTGAAGGACAGAGCACACCAAGT
CGCTTTGATCAACAGGTTTGTCGTTTTCTCTTTTTCTCATTCATCGCAGGACTCATACTTTTTCAGAGGAAATCT
TCCGCGGATGAGGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail