Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|031520
Gene name
Locationscaffold_12:984524..987038
Strand-
Gene length (bp)2514
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125) 3.1E-156 84 493

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10449|MU157_SCHPO Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug157 PE=1 SV=1 33 509 5.0E-139

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|031520
MGLLNVIFGLMKLNAKSIVLALTGLAVHSTAQCPDYTGYSQEPQGDPSNGPLGLPFMRPAPACRTFNSTAVEKVI
SDMKTLLKDPDIARLFENTFPNTLDTTVRYYSQQENLAFIITGDITAQWLRDTANQFAHYGTLLGQDPELAQLVK
AVINNEARYVSQYPYCGSFQPPPESGLAPSHNDWADGVTVNPPVDNQTVFECKYELDSLCGFLKLSRLYYTNTKD
TSFMNDNWRTAIDQIFRVINEQSQATFDKDFNFISFYNWTGGNGALSPMVPNRGNGEPKAFTGLVGTHHRPSDDL
SVFAFLTPANAMLSVELTHLAEILDQTNELKNVSQQAKEWSSRIHKAIWDTTVVDDIFAYETNGFGGRYVMDDAN
IPSLISLPYLGFLEKKNPAYVATRKQLLSAKNPYFAAGKKFQGVGGPHVDPWHPWPMSQIAAIFGTDDDEEILKS
LYLVVNNTAGLGLIHESQSIYDEKDYTRSWFAWANSFFAEMVLDLADRKPSLVLKRNESYRPGLNL*
Coding >Agabi119p4|031520
ATGGGTCTGCTGAATGTCATCTTTGGTCTCATGAAATTGAACGCAAAAAGCATAGTGCTTGCCTTGACTGGCCTA
GCCGTCCACTCCACCGCGCAATGTCCGGATTATACGGGATATTCACAAGAACCCCAGGGAGATCCTTCTAACGGA
CCATTGGGCCTACCTTTCATGCGACCTGCTCCAGCTTGTCGGACATTTAACAGCACAGCTGTCGAGAAAGTTATC
AGCGACATGAAAACGTTACTGAAAGACCCAGACATCGCTCGATTGTTTGAGAATACCTTCCCGAACACGCTAGAT
ACGACTGTCAGGTACTATAGCCAACAAGAAAACCTCGCTTTCATTATCACTGGAGACATAACTGCCCAATGGCTG
CGTGACACTGCCAATCAGTTTGCTCACTATGGTACACTCCTTGGGCAAGACCCGGAGCTGGCGCAGCTCGTTAAG
GCTGTCATCAACAACGAAGCCCGTTACGTCTCGCAGTACCCGTACTGTGGCTCATTCCAACCTCCTCCAGAAAGT
GGTCTAGCTCCTTCGCACAATGACTGGGCGGATGGCGTAACTGTGAACCCGCCTGTGGACAATCAAACTGTATTC
GAGTGCAAATATGAACTTGACTCCCTATGTGGCTTCCTCAAGCTCTCGCGCCTTTACTACACGAATACCAAGGAT
ACATCCTTCATGAATGATAACTGGCGCACGGCCATTGACCAGATCTTCAGAGTCATCAATGAACAGTCGCAAGCT
ACTTTTGATAAAGATTTCAACTTTATCTCGTTTTACAACTGGACTGGCGGAAATGGCGCCTTGTCACCTATGGTG
CCCAATCGAGGAAACGGGGAGCCCAAAGCATTTACAGGCTTAGTAGGTACTCATCATCGGCCTTCTGATGATTTG
AGTGTCTTTGCCTTCTTGACACCGGCGAACGCAATGCTCAGTGTCGAATTAACACACCTCGCTGAAATATTAGAT
CAGACCAACGAGCTCAAGAATGTCAGCCAACAGGCAAAGGAATGGAGCTCCCGGATACATAAGGCTATTTGGGAC
ACGACGGTAGTCGATGACATATTTGCGTACGAGACAAATGGATTCGGTGGCAGATACGTCATGGACGATGCAAAT
ATTCCATCTTTGATTTCTCTTCCATATCTGGGGTTCCTTGAGAAAAAGAATCCCGCTTATGTAGCCACCCGAAAG
CAGCTATTATCTGCAAAGAATCCTTACTTTGCTGCGGGTAAAAAGTTCCAAGGTGTTGGAGGGCCTCACGTTGAT
CCGTGGCATCCCTGGCCCATGTCCCAGATCGCGGCCATCTTTGGCACTGACGACGATGAAGAAATTCTCAAATCC
TTGTACTTGGTAGTCAACAATACGGCAGGTCTTGGTCTAATACACGAGTCACAATCGATCTATGACGAGAAGGAT
TATACTCGAAGTTGGTTTGCGTGGGCCAACAGCTTTTTTGCGGAGATGGTGTTAGATTTGGCGGATCGGAAGCCA
AGCCTAGTGTTGAAACGGAATGAAAGCTACCGGCCTGGTTTGAATTTGTGA
Transcript >Agabi119p4|031520
ATGGGTCTGCTGAATGTCATCTTTGGTCTCATGAAATTGAACGCAAAAAGCATAGTGCTTGCCTTGACTGGCCTA
GCCGTCCACTCCACCGCGCAATGTCCGGATTATACGGGATATTCACAAGAACCCCAGGGAGATCCTTCTAACGGA
CCATTGGGCCTACCTTTCATGCGACCTGCTCCAGCTTGTCGGACATTTAACAGCACAGCTGTCGAGAAAGTTATC
AGCGACATGAAAACGTTACTGAAAGACCCAGACATCGCTCGATTGTTTGAGAATACCTTCCCGAACACGCTAGAT
ACGACTGTCAGGTACTATAGCCAACAAGAAAACCTCGCTTTCATTATCACTGGAGACATAACTGCCCAATGGCTG
CGTGACACTGCCAATCAGTTTGCTCACTATGGTACACTCCTTGGGCAAGACCCGGAGCTGGCGCAGCTCGTTAAG
GCTGTCATCAACAACGAAGCCCGTTACGTCTCGCAGTACCCGTACTGTGGCTCATTCCAACCTCCTCCAGAAAGT
GGTCTAGCTCCTTCGCACAATGACTGGGCGGATGGCGTAACTGTGAACCCGCCTGTGGACAATCAAACTGTATTC
GAGTGCAAATATGAACTTGACTCCCTATGTGGCTTCCTCAAGCTCTCGCGCCTTTACTACACGAATACCAAGGAT
ACATCCTTCATGAATGATAACTGGCGCACGGCCATTGACCAGATCTTCAGAGTCATCAATGAACAGTCGCAAGCT
ACTTTTGATAAAGATTTCAACTTTATCTCGTTTTACAACTGGACTGGCGGAAATGGCGCCTTGTCACCTATGGTG
CCCAATCGAGGAAACGGGGAGCCCAAAGCATTTACAGGCTTAGTAGGTACTCATCATCGGCCTTCTGATGATTTG
AGTGTCTTTGCCTTCTTGACACCGGCGAACGCAATGCTCAGTGTCGAATTAACACACCTCGCTGAAATATTAGAT
CAGACCAACGAGCTCAAGAATGTCAGCCAACAGGCAAAGGAATGGAGCTCCCGGATACATAAGGCTATTTGGGAC
ACGACGGTAGTCGATGACATATTTGCGTACGAGACAAATGGATTCGGTGGCAGATACGTCATGGACGATGCAAAT
ATTCCATCTTTGATTTCTCTTCCATATCTGGGGTTCCTTGAGAAAAAGAATCCCGCTTATGTAGCCACCCGAAAG
CAGCTATTATCTGCAAAGAATCCTTACTTTGCTGCGGGTAAAAAGTTCCAAGGTGTTGGAGGGCCTCACGTTGAT
CCGTGGCATCCCTGGCCCATGTCCCAGATCGCGGCCATCTTTGGCACTGACGACGATGAAGAAATTCTCAAATCC
TTGTACTTGGTAGTCAACAATACGGCAGGTCTTGGTCTAATACACGAGTCACAATCGATCTATGACGAGAAGGAT
TATACTCGAAGTTGGTTTGCGTGGGCCAACAGCTTTTTTGCGGAGATGGTGTTAGATTTGGCGGATCGGAAGCCA
AGCCTAGTGTTGAAACGGAATGAAAGCTACCGGCCTGGTTTGAATTTGTGA
Gene >Agabi119p4|031520
ATGGGTCTGCTGAATGTCATCTTTGGTCTCATGAAATTGAACGCAAAAAGCATAGTGCTTGCCTTGACTGGCCTA
GCCGTCCACTCCACCGCGCAATGTCCGGATTATACGGGATATTCACAAGTGAGTATCGTTTCCGTGTTATATTTC
CTCTTATTTACAGCCAACGCACCCTCTAGGAACCCCAGGGAGATCCTTCTAACGGACCATTGGGCCTACCTTTCA
TGCGACCTGCTCCAGCTTGTCGGACATTTAACAGCACAGCTGTCGAGGTGGGTAATTGTATTCTTACTTTATCCG
AACACTCATATAGATGACAATATAGAAAGTTATCAGCGACATGAAAACGTTACTGAAAGACCCAGACATCGCTCG
ATTGTTTGAGAATACCTTCCCGAACACGCTAGGTATCTTGTCAAATTCACAAGCGTTTATGCGTAATTGACGAGA
TGCAAGATACGACTGTCAGGTACTATAGCCAAGTAAGCTTATTCCCGTGGCGCGTGGCGGAGTCTTACTATGCTA
TCTTCCGTCGCAGCAAGAAAACCTCGCTTTCATTATCACTGGAGTAAGCATGTTCCATGTCTCTAGAATATACAT
TAACCAATTCCTTCTTCTAGGACATAACGTACGTGATTTCACTCAATAAACAACGTATGGCAATTGAACATATTG
TAGTGCCCAATGGCTGCGTGACACTGCCAATCAGGTTTGTTGCTCATCTACAATCTATGCTATGTTCCCTCACCT
ACGCCACGCAGTTTGCTCACTATGGTACACTCCTTGGGCAAGACCCGGAGCTGGCGCAGCTCGTTAAGGCTGTCA
TCAACAACGAAGCCCGTTACGTCTCGCAGTACCCGTACTGTGAGTAGCTATCATTCCTACCCTGCTTTTCATCCA
TAGCTGAACCTATTAGGTGGCTCATTCCAACCTCCTCCAGAAAGTGGTCTAGCTCCTTCGCACAATGACTGGGCG
GATGGCGTAACTGTGAACCCGTAGGTATCCAATACGGATCATAGAAATGAAGCTCAACGAATGAGGTAGGCCTGT
GGACAATCAAACTGTATTCGAGTGCAAAGTAAAACATCTCCATGGCAAATCTCTATCTTGAAATGCTTACCATCC
ACGCGACTAGTATGAACTTGACTCCCTATGTGGCTTCCTCAAGCTCTCGCGCCTTTACTACACGAATACCAAGGA
TACATCCTTCATGAATGATAACTGTATGAATAACTTTTTCTTTCGCGAGGCTCCGCATTAATAAACCATGATTAA
TCCAGGGCGCACGGCCATTGACCAGATCTTCAGAGTCATCAATGAACAGTCGCAAGCTACTTTTGATAAAGATTT
CAACTTTATCTCGTTTTACAACTGGACTGGCGGAAATGGCGCCTTGTCACCTATGGTGCCCAATCGAGGAAACGG
GGAGCCCAAAGCATTTACAGGCTTAGTAGGTACTCATCATCGGCCTTCTGATGATTTGAGTGTCTTTGGTAAGTA
ATGACAATTTTGGAGAACTCTTCAAGATGAAAACTCCTTTTAGCCTTCTTGACACCGGCGAACGCAATGCTCAGT
GTCGAATTAACACACCTCGCTGAAATATTAGATCAGACCAACGAGCTCAAGAATGTCAGCCAACAGGCAAAGGAA
TGGAGCTCCCGGATACATAAGGCTATTTGGGACACGACGGTAAGGCCCCGACAATATATTCTGCGCGTAGTAAAT
TCACTGACACGCTCATCAACAGGTAGTCGATGACATATTTGCGTACGAGACAAATGGTAAATTCGGTAATTTTAA
CTATGAGAGGCGAGGACTGAAAGCGAATGCCTGTAGGATTCGGTGGCAGATACGTCATGGACGATGCAAATATTC
CAGTAAGGGATACTCCTCTAACTTATCTGCCGAAGAATTGACCGTCTTTGGAGTCTTTGATTTCTCTTCCATATC
TGGGGTTCCTTGAGAAAAAGAATCCCGCTTATGTAGCCACCCGAAAGCAGCTATTATCTGCAAAGAATCCTTACT
TTGCTGCGGGTAAAAAGTTCCAAGGTGTTGGGTGCGTCGTGGTCGAAAAAAATGTATCCTCCTTGATTCTGCCCA
TTAACTGAACCACCGTAGAGGGCCTCACGTTGATCCGTGGCATCCCTGGTATGGGTACTTCAGCTCGGTGGAAGT
CTGAATCTGACATATCTGCCTAGGCCCATGTCCCAGATCGCGGCCATCTTTGGCACTGACGACGATGAAGAAATT
CTCAAATCCTTGTACTTGGTAGTCAACGTAAGAATGAATTCTTCGTCTCAAGCCGAAATGTGGTCCTGATTATTT
GCCTAGAATACGGCAGGTCTTGGTCTAATACACGAGTCACAATCGATCTATGACGAGAAGGATTATACTCGAAGT
TGGTTTGCGTGGGCCAACAGCTTTTTTGCGGAGATGGTGTTAGATTTGGCGGATCGGAAGCCAAGCCTAGTGTTG
AAACGGAATGAAAGCTACCGGCCTGGTTTGAATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail